Property Summary

NCBI Gene PubMed Count 8
PubMed Score 133.45
PubTator Score 126.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MDNMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCFGA      1 - 70
TECEAQQTSHCLKEWCACFL                                                       71 - 90
//

Text Mined References (8)

PMID Year Title