Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $27,502.71
PubMed Score 129.98
PubTator Score 126.29

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDNMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCFGA      1 - 70
TECEAQQTSHCLKEWCACFL                                                       71 - 90
//

Text Mined References (8)

PMID Year Title
21630459 2011 Proteomic characterization of the human sperm nucleus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16337940 2006 Barrier-to-autointegration factor-like (BAF-L): a proposed regulator of BAF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.