Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.01
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.100 7.5e-04
malignant mesothelioma 1.100 2.7e-05
medulloblastoma, large-cell 1.100 1.8e-02
osteosarcoma 1.484 5.5e-04
ovarian cancer 1.800 1.7e-04
pediatric high grade glioma 1.200 6.4e-03
Rheumatoid arthritis 1.100 1.2e-02
subependymal giant cell astrocytoma 2.563 4.4e-02

Gene RIF (1)

AA Sequence

MSSKQEIMSDQRFRRVAKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNYAVDKRGRPISHSTTEDLKR      1 - 70
FYDLSDSDSNLSGEDSKALSQKKIKKKKTQTKKEIDSKNLVEKKKETKKANHKGSENKTDLDNSIGIKKM     71 - 140
KTSCKFKIDSNISPKKDSKEFTQKNKKEKKNIVQHTTDSSLEEKQRTLDSGTSEIVKSPRIECSKTRREM    141 - 210
QSVVQLIMTRDSDGYENSTDGEMCDKDALEEDSESVSEIGSDEESENEITSVGRASGDDDGSEDDEEEDE    211 - 280
DEEEDEDEDSEDDDKSDSGPDLARGKGNIETSSEDEDDTADLFPEESGFEHAWRELDKDAPRADEITRRL    281 - 350
AVCNMDWDRLKAKDLLALFNSFKPKGGVIFSVKIYPSEFGKERMKEEQVQGPVELLSIPEDAPEKDWTSR    351 - 420
EKLRDYQFKRLKYYYAVVDCDSPETASKIYEDCDGLEFESSCSFIDLRFIPDDITFDDEPKDVASEVNLT    421 - 490
AYKPKYFTSAAMGTSTVEITWDETDHERITMLNRKFKKEELLDMDFQAYLASSSEDEEEIEEELQGDDGV    491 - 560
NVEEDGKTKKSQKDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPGLKESAEEMVKNKLEGKDKLT    561 - 630
PWEQFLEKKKEKKRLKRKQKALAEEASEEELPSDVDLNDPYFAEEVKQIGINKKSVKSAKDGTSPEEEIE    631 - 700
IERQKAEMALLMMDEDEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELIEDDFEVNVNDARFQAMYTSHL    701 - 770
FNLDPSDPNFKKTKAMEKILEEKARQRERKEQELTQAIKKKESEIEKESQRKSIDPALSMLIKSIKTKTE    771 - 840
QFQARKKQKVK                                                               841 - 851
//

Text Mined References (23)

PMID Year Title