Property Summary

NCBI Gene PubMed Count 11
Grant Count 16
R01 Count 9
Funding $1,294,000.47
PubMed Score 5.53
PubTator Score 5.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma -1.500 0.000
malignant mesothelioma 1.300 0.000
astrocytic glioma -1.100 0.027
oligodendroglioma -1.100 0.020
cutaneous lupus erythematosus -1.100 0.001
osteosarcoma -2.039 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.300 0.000
medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.600 0.000
tuberculosis and treatment for 6 months 1.600 0.000
lung cancer 1.700 0.011

Gene RIF (3)

PMID Text
19682092 These results suggest that Pin1 may have overlapping cellular function with PCIF1.
18294453 These data suggest that icariin exerts its potent osteogenic effect through induction of Runx2 expression, production of BMP-4 and activation of BMP signaling.
12565871 Data suggest that phosphorylated CTD interacting factor 1 (PCIF1) may play a role in mRNA synthesis by modulating RNA polymerase II activity.

AA Sequence

MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQS      1 - 70
LWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQS     71 - 140
VPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHRGPSEVLPPHPEVELLRSQLIL    141 - 210
KLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKF    211 - 280
REEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVS    281 - 350
AAAKDSVEGICSKIYHISLEYVKRIREKHLAILKENNISEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE    351 - 420
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGVGLYEGTGLQ    421 - 490
GSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEEL    491 - 560
MDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLILPAFEHEYRSGSQHICKKEE    561 - 630
MHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSAAYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSRE    631 - 700
PHPT                                                                      701 - 704
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19682092 2009 Prolyl isomerase Pin1 shares functional similarity with phosphorylated CTD interacting factor PCIF1 in vertebrate cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18294453 2008 Human phosphorylated CTD-interacting protein, PCIF1, negatively modulates gene expression by RNA polymerase II.
More...