Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.67
PubTator Score 5.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 2.7e-02
atypical teratoid / rhabdoid tumor 1.100 3.6e-04
cutaneous lupus erythematosus -1.100 1.0e-03
glioblastoma 1.300 8.0e-07
group 3 medulloblastoma 1.200 1.3e-02
hepatocellular carcinoma -1.500 5.1e-05
lung cancer 1.700 1.1e-02
malignant mesothelioma 1.200 9.4e-06
medulloblastoma, large-cell 1.600 9.2e-06
oligodendroglioma -1.100 2.0e-02
osteosarcoma -2.039 1.1e-08
tuberculosis and treatment for 6 months 1.600 2.0e-05

Synonym

Accession Q9H4Z3 E1P5P1 Q54AB9 Q9NT85
Symbols C20orf67
PPP1R121

Gene

PDB

2JX8  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQS      1 - 70
LWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQS     71 - 140
VPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHRGPSEVLPPHPEVELLRSQLIL    141 - 210
KLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKF    211 - 280
REEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVS    281 - 350
AAAKDSVEGICSKIYHISLEYVKRIREKHLAILKENNISEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE    351 - 420
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGVGLYEGTGLQ    421 - 490
GSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEEL    491 - 560
MDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLILPAFEHEYRSGSQHICKKEE    561 - 630
MHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSAAYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSRE    631 - 700
PHPT                                                                      701 - 704
//

Text Mined References (18)

PMID Year Title