Property Summary

NCBI Gene PubMed Count 71
PubMed Score 57.56
PubTator Score 51.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 7.4e-03
astrocytic glioma -1.400 2.8e-03
atypical teratoid/rhabdoid tumor -1.100 2.7e-04
Breast cancer -1.100 1.4e-06
cystic fibrosis 1.762 3.7e-06
ependymoma -1.300 8.0e-03
glioblastoma -1.200 2.8e-04
group 3 medulloblastoma -1.200 3.3e-02
interstitial cystitis -2.300 1.7e-03
invasive ductal carcinoma 1.800 4.6e-02
lung carcinoma 1.400 2.5e-32
medulloblastoma, large-cell -1.200 1.6e-02
primary Sjogren syndrome -1.100 1.4e-03
primitive neuroectodermal tumor -1.200 3.3e-03
spina bifida -1.438 2.2e-02

Protein-protein Interaction (4)

Gene RIF (74)

AA Sequence

MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG      1 - 70
HIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGREC     71 - 140
TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD    141 - 210
PTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC                                         211 - 243
//

Text Mined References (71)

PMID Year Title