Property Summary

NCBI Gene PubMed Count 67
Grant Count 4
Funding $1,076,506
PubMed Score 53.80
PubTator Score 51.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.400 0.003
ependymoma -1.300 0.008
medulloblastoma -1.500 0.000
cystic fibrosis 1.762 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.002
primitive neuroectodermal tumor -1.200 0.003
interstitial cystitis -3.300 0.000
adult high grade glioma -1.300 0.001
atypical teratoid/rhabdoid tumor -1.100 0.000
primary Sjogren syndrome -1.100 0.001
inflammatory breast cancer -1.600 0.010
lung carcinoma 1.400 0.000
spina bifida -1.438 0.022
invasive ductal carcinoma 1.800 0.046

Gene RIF (71)

PMID Text
25892883 GSTO2 and GSTP1 gene polymorphisms may serve as independent prognostic markers for hepatocellular carcinoma patients.
25835968 we for the first time provided evidence supporting the prognostic role of GSTO2 in the progression of TACE-treated hepatocellular carcinoma
25726706 No significant association has been found between childhood Pre-B acute lymphoblastic leukemia and GSTO1 A140D and GSTO2 N142D polymorphisms.
25716313 Our results indicate that GSTO1*C/GSTO2*G haplotype is associated with increased risk of TCC. The modifying effect of GSTO2*G/G genotype on individual susceptibility to TCC is more pronounced, when associated with smoking.
25491248 The present study found that rs3740400 in As3MT and rs156697 in GSTO2 were strongly associated with the arsenic species (%iAs, %MMA and MMA/iAs and DMA/MMA ratios) in urine of the occupationally exposed workers and they may influence methylation capacity.
24471578 The GSTA1*-69T and GSTO2*D142 variants are both associated with a significantly increased risk of asthma.
24040330 GSTT1 active genotype and GSTO1 Asp140Asp and GSTO2 Asp142Asp genotypes may have a prognostic/pharmacogenomic role in patients with muscle invasive bladder cancer.
23927022 The results indicate that mutant GSTO2*Asp genotype is associated with increased risk of age-related cataract in smokers and ultraviolet-exposed subjects, suggesting a role of inefficient ascorbate regeneration in cataract development.
23649768 No significant association between GSTO2 polymorphism and acute renal graft rejection.
23086268 The frequencies of GSTO1 and GSTO2 genotypes were not significantly different between head and neck squamous cell carcinoma cases and controls.
More...

AA Sequence

MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG      1 - 70
HIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGREC     71 - 140
TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD    141 - 210
PTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC                                         211 - 243
//

Text Mined References (67)

PMID Year Title
25892883 2015 Polymorphisms of glutathione S-transferase genes and survival of resected hepatocellular carcinoma patients.
25835968 2015 Glutathione S-transferase O2 gene rs157077 polymorphism predicts response to transarterial chemoembolization in hepatocellular carcinoma.
25726706 2015 Childhood Pre-B acute lymphoblastic leukemia and glutathione S-transferase omega 1 and 2 polymorphisms.
25716313 2015 GSTO1*C/GSTO2*G haplotype is associated with risk of transitional cell carcinoma of urinary bladder.
25491248 2015 Biological monitoring and the influence of genetic polymorphism of As3MT and GSTs on distribution of urinary arsenic species in occupational exposure workers.
25416956 2014 A proteome-scale map of the human interactome network.
24471578 2014 GSTA1*-69C/T and GSTO2*N142D as asthma- and allergy-related risk factors in Italian adult patients.
24040330 2013 Glutathione S-transferase T1, O1 and O2 polymorphisms are associated with survival in muscle invasive bladder cancer patients.
23927022 2014 Glutathione S-transferase omega-2 polymorphism Asn142Asp modifies the risk of age-related cataract in smokers and subjects exposed to ultraviolet irradiation.
23649768 2013 Influence of GSTO2 (N142D) genetic polymorphism on acute renal rejection.
More...