Property Summary

NCBI Gene PubMed Count 32
Grant Count 105
R01 Count 81
Funding $8,784,783.48
PubMed Score 138.51
PubTator Score 26.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H4X1 Q6NZ48 Q9UL69
Symbols RGC32
RGC-32
C13orf15
bA157L14.2

Gene

Gene RIF (19)

PMID Text
25655049 Data suggest that expression of RGC32 is down-regulated in placental trophoblasts in women with pre-eclampsia as compared to women with normal term pregnancies; silencing RGC32 expression by RNA interference inhibits trophoblast migration/invasion.
25418473 RGC-32 expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4.
25230890 In conclusion, the present study indicates that C5a may promote the proliferation of breast cancer cells through Akt1 activation of the RGC-32 gene.
24973210 results demonstrate for the first time that RGC-32 is a novel membrane regulator for macrophage phagocytosis.
24833469 Suggest that RGC32 is involved in tumorigenesis of human lung cancer, inducing apoptosis and inhibiting cell growth, migration, and invasion.
23715780 RGC32 promotes cell migration and invasion and induces epithelial-mesenchymal transition in lung cancer cells via the NF-kappaB signaling pathway.
23000427 data suggest RGC-32 plays a dual role in multiple sclerosis, both as a regulator of T-cells mediated apoptosis and as a promoter of TGF-beta-mediated profibrotic effects in astrocytes
22163048 analysis of upregulation of the cell-cycle regulator RGC-32 in Epstein-Barr virus-immortalized cells, due to transcriptional activation by high levels of the differentially expressed RUNX1c transcription factor
21307346 Data demonstrate that RGC-32 interacts with Smad3 to mediate the epithelial-mesenchymal transition of human renal proximal tubular cells.
20862745 methylation-associated down-regulation of RGC32 plays an important role in the pathogenesis of NSCLC, particularly in females
More...

AA Sequence

MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD      1 - 70
SSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM        71 - 137
//

Text Mined References (34)

PMID Year Title
25655049 2015 Expression of RGC32 in human normal and preeclamptic placentas and its role in trophoblast cell invasion and migration.
25418473 2015 Response gene to complement 32 (RGC-32) expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4.
25230890 2014 C5a stimulates the proliferation of breast cancer cells via Akt-dependent RGC-32 gene activation.
24973210 2014 Response gene to complement 32 protein promotes macrophage phagocytosis via activation of protein kinase C pathway.
24833469 2014 Knockdown of response gene to complement 32 (RGC32) induces apoptosis and inhibits cell growth, migration, and invasion in human lung cancer cells.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23715780 2013 Overexpression of response gene to complement 32 (RGC32) promotes cell invasion and induces epithelial-mesenchymal transition in lung cancer cells via the NF-?B signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23000427 2013 Dual role of Response gene to complement-32 in multiple sclerosis.
22163048 2011 Upregulation of the cell-cycle regulator RGC-32 in Epstein-Barr virus-immortalized cells.
More...