Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $388,746.5
PubMed Score 126.14
PubTator Score 37.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -3.027 0.001
sonic hedgehog group medulloblastoma 5.900 0.000
medulloblastoma, large-cell 4.900 0.000
primitive neuroectodermal tumor 2.200 0.039
breast carcinoma -1.100 0.007
fibroadenoma -1.600 0.007
interstitial cystitis 1.100 0.001
lung carcinoma 1.100 0.000
ductal carcinoma in situ -2.100 0.000
invasive ductal carcinoma -2.900 0.001

Gene RIF (6)

PMID Text
25609158 Early B-cell factor 3 (EBF3) is a novel tumor suppressor gene with promoter hypermethylation in pediatric acute myeloid leukemia
21387304 EBF3 tumor suppressor is epigenetically silenced and that it serves as an independent prognostic marker in gastric carcinoma.
20029986 Results verify IRX1, EBF3, SLC5A8, SEPT9, and FUSSEL18 as valid methylation markers in two separate sets of HNSCC specimens; also preliminarily show a trend between HPV16 positivity and target gene hypermethylation of IRX1, EBF3, SLC5A8, and SEPT9.
18845077 Findings suggested that the transfection of EBF3 gene into HepG2 induced the cell proliferation from G1 phase to G2 phase by increasing the number of cells.
18559491 Frequent methylation of EBF3 gene is associated with head and neck squamous cell carcinoma
17018599 Expression of EBF3 resulted in cell cycle arrest and apoptosis. EBF3 regulates a transcriptional program underlying a putative tumor suppression pathway.

AA Sequence

MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHF      1 - 70
VLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIV     71 - 140
YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRR    141 - 210
FQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGAT    211 - 280
VIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNE    281 - 350
PTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHN    351 - 420
QIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSM    421 - 490
NGYGSGAMASLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCSSTHGIFSFSPANVISAVKQK    491 - 560
SAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM                                      561 - 596
//

Text Mined References (16)

PMID Year Title
25609158 2015 Early B-cell factor 3 (EBF3) is a novel tumor suppressor gene with promoter hypermethylation in pediatric acute myeloid leukemia.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
21387304 2012 Aberrant DNA methylation and tumor suppressive activity of the EBF3 gene in gastric carcinoma.
20592035 2010 Structural determination of functional domains in early B-cell factor (EBF) family of transcription factors reveals similarities to Rel DNA-binding proteins and a novel dimerization motif.
20029986 2010 HPV status-independent association of alcohol and tobacco exposure or prior radiation therapy with promoter methylation of FUSSEL18, EBF3, IRX1, and SEPT9, but not SLC5A8, in head and neck squamous cell carcinomas.
19996307 2009 Emerging roles of the EBF family of transcription factors in tumor suppression.
18845077 2008 [Construction of eukaryotic expression vector for EBF3 and EGFP fusion protein and its expression in HepG2 cells].
18559491 2008 Frequently methylated tumor suppressor genes in head and neck squamous cell carcinoma.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17018599 2006 An EBF3-mediated transcriptional program that induces cell cycle arrest and apoptosis.
More...