Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.16
PubTator Score 2.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (2)

AA Sequence

MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALTQLWELCRQWL      1 - 70
RPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLERELDEPGKQVPGNSERRDIL     71 - 140
MDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDT    141 - 210
PQHPKSKDIIENEGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLI    211 - 280
GHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY      281 - 348
//

Text Mined References (11)

PMID Year Title