Property Summary

NCBI Gene PubMed Count 6
PubMed Score 46.66
PubTator Score 19.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.8e-11
medulloblastoma, large-cell 6241 2.1e-05
glioblastoma 5792 1.0e-03
adult high grade glioma 3801 1.2e-03
Disease Target Count Z-score Confidence
Cystinosis 14 3.024 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.400 1.2e-03
glioblastoma 1.200 1.0e-03
medulloblastoma, large-cell 1.100 2.1e-05
ovarian cancer 2.200 1.8e-11

Gene RIF (1)

AA Sequence

MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGP      1 - 70
PGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSS     71 - 140
SNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSN    141 - 210
HRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP                    211 - 264
//

Text Mined References (7)

PMID Year Title