Property Summary

NCBI Gene PubMed Count 6
Grant Count 24
R01 Count 18
Funding $3,537,494.66
PubMed Score 45.16
PubTator Score 19.11

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
19460469 the study ruled out microdeletions on the critical region as a common cause of Moebius syndrome and excluded GSH1 gene

AA Sequence

MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGP      1 - 70
PGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSS     71 - 140
SNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSN    141 - 210
HRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP                    211 - 264
//

Text Mined References (7)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
19460469 Molecular genetic screening of MBS1 locus on chromosome 13 for microdeletions and exclusion of FGF9, GSH1 and CDX2 as causative genes in patients with Moebius syndrome.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
11731616 2001 Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene promoter.
7518789 1994 Identification of homeobox genes expressed in human haemopoietic progenitor cells.