Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.49
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.031 2.0e-03
psoriasis 1.400 3.0e-04

Gene RIF (4)

AA Sequence

MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQ      1 - 70
SFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVF     71 - 140
NEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL    141 - 210
GIPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRF    211 - 280
SQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAA    281 - 350
AAAAAAAAAHHLPAMVL                                                         351 - 367
//

Text Mined References (14)

PMID Year Title