Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.30
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.031 0.002
psoriasis 1.400 0.000

Synonym

Accession Q9H4Q4 A3KFK9
Symbols PFM9
HSAN8

Gene

PDB

3EP0  

Gene RIF (3)

PMID Text
26005867 Prdm12 is a key factor in the orchestration of sensory neurogenesis.
25891934 PRDM12 and its functional fly homolog Hamlet are evolutionary conserved master regulators of sensory neuronal specification and play a critical role in pain perception
14523459 Down-regulation of PRDM12 is associated with the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion

AA Sequence

MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQ      1 - 70
SFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVF     71 - 140
NEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL    141 - 210
GIPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRF    211 - 280
SQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAA    281 - 350
AAAAAAAAAHHLPAMVL                                                         351 - 367
//

Text Mined References (8)

PMID Year Title
26005867 2015 Transcriptional regulator PRDM12 is essential for human pain perception.
25891934 2015 The evolutionarily conserved transcription factor PRDM12 controls sensory neuron development and pain perception.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14675547 2003 SET domains and histone methylation.
14523459 2004 A potential role for PRDM12 in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.
11274145 2001 The prototypical 4.1R-10-kDa domain and the 4.1g-10-kDa paralog mediate fodrin-actin complex formation.
10668202 2000 The yin-yang of PR-domain family genes in tumorigenesis.