Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.34
PubTator Score 3.81

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
25546159 Findings indicate that Prdm13/Nkx2-1-mediated signaling in the DMC declines with advanced age, leading to decreased sleep quality and increased adiposity.

AA Sequence

MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESGGSPLEWIGL      1 - 70
IRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICW     71 - 140
YCWRTFRYPNSLKAHLRFHCVFSGGGGGAFLHHEHAARQGAVPAADGLGLSPKPPAPDFAAPSQAGTLRP    141 - 210
HPLGPPPVQACGAREGIKREASSAPSATSPTPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGIVGGSSA    211 - 280
GVGSLAFYPGVRSAFKPAGLARAAAAAHGDPYREESSSKQGAGLALGRLLGGGRACGRPGSGENSAAGGA    281 - 350
GHHHHHHAHHHHHPKCLLAGDPPPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAAAALPGARY    351 - 420
AQLPPAPGLPLERCALPPLDPGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAYYPLKLHFGGLL    421 - 490
KYPESISYFSGPAAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRGRLDSGTLPPAVAAAGGTGGGG    491 - 560
SGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPY    561 - 630
RCEFCGKVLVRRRDLERHVKSRHPGQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVG    631 - 700
GGGERDL                                                                   701 - 707
//

Text Mined References (5)

PMID Year Title
25546159 2015 Deficiency of Prdm13, a dorsomedial hypothalamus-enriched gene, mimics age-associated changes in sleep quality and adiposity.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12800201 2003 Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.
11181995 2001 The sequence of the human genome.