Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.57
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
non-syndromic intellectual disability 1 3.705 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.300 3.8e-04
group 3 medulloblastoma 2.300 8.2e-03
malignant mesothelioma 2.400 2.5e-06
medulloblastoma, large-cell 3.200 6.6e-04
psoriasis 2.500 2.6e-07

Gene RIF (2)

AA Sequence

MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESGGSPLEWIGL      1 - 70
IRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICW     71 - 140
YCWRTFRYPNSLKAHLRFHCVFSGGGGGAFLHHEHAARQGAVPAADGLGLSPKPPAPDFAAPSQAGTLRP    141 - 210
HPLGPPPVQACGAREGIKREASSAPSATSPTPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGIVGGSSA    211 - 280
GVGSLAFYPGVRSAFKPAGLARAAAAAHGDPYREESSSKQGAGLALGRLLGGGRACGRPGSGENSAAGGA    281 - 350
GHHHHHHAHHHHHPKCLLAGDPPPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAAAALPGARY    351 - 420
AQLPPAPGLPLERCALPPLDPGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAYYPLKLHFGGLL    421 - 490
KYPESISYFSGPAAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRGRLDSGTLPPAVAAAGGTGGGG    491 - 560
SGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPY    561 - 630
RCEFCGKVLVRRRDLERHVKSRHPGQSLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVG    631 - 700
GGGERDL                                                                   701 - 707
//

Text Mined References (6)

PMID Year Title