Property Summary

NCBI Gene PubMed Count 45
PubMed Score 44.95
PubTator Score 35.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.100 7.3e-07
astrocytic glioma -1.400 7.9e-03
Astrocytoma, Pilocytic -1.700 3.0e-10
atypical teratoid / rhabdoid tumor -2.000 3.8e-09
ependymoma -1.600 1.2e-02
glioblastoma -1.500 8.6e-08
osteosarcoma -1.263 6.6e-04
primitive neuroectodermal tumor -1.200 1.0e-03
subependymal giant cell astrocytoma -1.335 2.5e-02

Protein-protein Interaction (8)

Gene RIF (25)

AA Sequence

MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR      1 - 70
IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS     71 - 140
VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR    141 - 210
VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI    211 - 280
PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI                                     281 - 317
//

Text Mined References (50)

PMID Year Title