Property Summary

NCBI Gene PubMed Count 38
Grant Count 27
R01 Count 25
Funding $1,443,681.92
PubMed Score 42.24
PubTator Score 35.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -2.000 0.003
posterior fossa group A ependymoma -2.000 0.000
glioblastoma -1.800 0.001
osteosarcoma -2.395 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
primitive neuroectodermal tumor -1.200 0.001
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -2.732 0.003

 GO Component (1)

Gene RIF (22)

PMID Text
26963794 HPV 16 E2 can modulate ErbB-3 by interacting with Nrdp-1, which is involved in the regulation of this receptor, via ubiquitination and degradation.
26464195 ABPN downregulates multiple components of the EGFR/ErbB3 signaling pathway through Nrdp1 activation.
26088461 The results of this study suggested that Nrdp1-mediated ErbB3 degradation suppresses glioma migration and invasion and that loss of Nrdp1 may amplify ErbB3 signaling to contribute to glioma migration and invasion.
25926384 The regulation of MMP7 by Nrdp1 in CRC cells could be inhibited by miR-497 through suppressing Nrdp1 translation.
25519010 Nrdp1 may serve as a useful biomarker for the clinical outcome and efficacy of adjuvant anthracyclines-based chemotherapy in breast cancer.
25355637 Lower expression of Nrdp1 in human glioma contributes tumor progression by reducing apoptosis.
25330950 Our findings thus reveal Nrdp1, EGFR signaling, and MMP7 as promising therapeutic targets for preventing the metastasis of colorectal cancer .
24867101 Data suggest that neuregulin receptor degradation protein-1 (Nrtp1) may induce cell-cycle inhibitor p27 nuclear retention to directly inhibit proliferation of colorectal cancer (CRC) cells.
24519943 Coiled-coil domain deletion abrogates Nrdp1 oligomerization and suppresses Nrdp1 but not ErbB3 ubiquitination and degradation.
24259665 Phosphorylation of RNF41 by Par-1b regulates basolateral membrane targeting of laminin-111 receptors.
More...

AA Sequence

MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR      1 - 70
IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS     71 - 140
VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR    141 - 210
VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI    211 - 280
PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI                                     281 - 317
//

Text Mined References (43)

PMID Year Title
26963794 2016 Human papillomavirus 16 E2 interacts with neuregulin receptor degradation protein 1 affecting ErbB-3 expression in vitro and in clinical samples of cervical lesions.
26464195 2015 The retinoic acid derivative, ABPN, inhibits pancreatic cancer through induction of Nrdp1.
26088461 2015 Nrdp1-mediated ErbB3 degradation inhibits glioma cell migration and invasion by reducing cytoplasmic localization of p27(Kip1).
25926384 2015 MiR-497 promotes metastasis of colorectal cancer cells through Nrdp1 inhibition.
25519010 2015 Nrdp1 expression to predict clinical outcome and efficacy of adjuvant anthracyclines-based chemotherapy in breast cancer: A retrospective study.
25416956 2014 A proteome-scale map of the human interactome network.
25355637 2014 Lower expression of Nrdp1 in human glioma contributes tumor progression by reducing apoptosis.
25330950 2015 Nrdp1 inhibits metastasis of colorectal cancer cells by EGFR signaling-dependent MMP7 modulation.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24949970 2014 The diabetes susceptibility gene Clec16a regulates mitophagy.
More...