Property Summary

NCBI Gene PubMed Count 51
PubMed Score 434.97
PubTator Score 89.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.700 7.9e-04
osteosarcoma -1.501 1.2e-04
posterior fossa group A ependymoma 1.500 7.2e-08
glioblastoma 1.800 3.3e-05
medulloblastoma, large-cell 1.100 2.6e-03
tuberculosis and treatment for 6 months -1.500 1.5e-05
primary pancreatic ductal adenocarcinoma 1.326 5.3e-03
lung cancer -1.400 2.3e-02
pancreatic cancer 1.200 5.0e-03
pediatric high grade glioma 1.500 4.1e-05
pilocytic astrocytoma 1.100 6.8e-04
aldosterone-producing adenoma -1.097 3.2e-02
Polycystic Ovary Syndrome -1.031 5.4e-03
lung carcinoma -1.200 2.2e-20
gastric carcinoma 1.200 4.3e-02
ulcerative colitis 1.200 4.5e-05
ovarian cancer -1.300 1.9e-07

Protein-protein Interaction (3)

Gene RIF (22)

PMID Text
26465136 van der Waals interactions should be the main consideration when we design peptide inhibitors of EHD1 EH domain with high affinities.
26378252 Authors found that Eps15-homology domain 1 (EHD1), a protein that associates with the endocytic recycling compartment (ERC), colocalizes with active R-Ras in transiently expressed HeLa cells.
25595798 Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.
25287187 that Molecule Interacting with CasL Like-1 and Eps15 Homology Domain protein 1 differentially influence microtubule dynamics during early and late mitosis
24946721 Data indicate that concordant transforming growth factor-beta1 (TGFbeta-1) positive and EH-domain containing 1 (EHD1) negative as a strong favorable prognosis factor in non-small cell lung cancer (NSCLC).
24481818 MICAL-L1-mediated recruitment of EHD1 to Src-containing recycling endosomes is required for the release of Src from the perinuclear endocytic recycling compartment in response to growth factor stimulation.
24019528 evidence that the functions of both EHD1 and EHD4 are primarily in TRE membrane vesiculation, whereas EHD3 is a membrane-tubulating protein.
22456504 the lipid modifier cPLA2alpha and EHD1 are involved in the vesiculation of CD59-containing endosomes
22284051 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function
20961375 EHD1 is involved in the control of CD59 transport from pre-sorting endosomes to the ERC in a PKC-dependent manner
20489164 A new class of cardiac trafficking proteins(EHD1, EHD2, EHD3, EHD4) regulates cardiac membrane protein targeting.
19864458 These data implicate MICAL-L1 as an unusual type of Rab effector that regulates endocytic recycling by recruiting and linking EHD1 and Rab8a on membrane tubules.
19798736 The results indicate that NPF is the preferred binding motif for the EHD1 EH-domain, but both the DPF and GPF motifs are capable of binding with lower affinity.
19369419 Data show that EH domain mutant (K483E) that associates exclusively with punctate membranes displayed decreased binding to phosphatidylinositol-4-phosphate and other phosphoinositides.
18661112 Results show that EHD1 undergoes serine-phosphorylation, and suggest that EHD1 phosphorylation occurs between early endosomes and the endocytic recycling compartment.
17899392 Solution structure of the 133 C-terminal residues of EHD1, which includes the EH domain, was solved.
17507647 Rab8a and Myosin Vb colocalize to a tubular network containing EHD1 and EHD3, which does not contain Rab11a.
17284518 Data support a role for EHD1 in beta1 integrin recycling, and demonstrate a requirement for EHD1 in integrin-mediated downstream functions.
15710626 ATP binding is required for oligomerization of mRme-1/EHD1, which in turn is required for its association with endosomes
15020713 a novel interacting partner for EHD1, rabenosyn-5, was revealed.
12121420 EHD3: a protein that resides in recycling tubular and vesicular membrane structures and interacts with EHD1.
12032069 A tubular EHD1-containing compartment involved in the recycling of major histocompatibility complex class I molecules to the plasma membrane

AA Sequence

MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG      1 - 70
KTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQ     71 - 140
LPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH    141 - 210
EDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFK    211 - 280
DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISP    281 - 350
GDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG    351 - 420
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADV    421 - 490
DKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE                              491 - 534
//

Text Mined References (65)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
26465136 2015 Molecular dynamics simulation of the interactions between EHD1 EH domain and multiple peptides.
26378252 2015 ARF-GEF cytohesin-2/ARNO regulates R-Ras and ?5-integrin recycling through an EHD1-positive compartment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686250 2015 Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
25595798 2015 Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25287187 2015 Novel functions for the endocytic regulatory proteins MICAL-L1 and EHD1 in mitosis.
24946721 2014 Expression of TGF?-1 and EHD1 correlated with survival of non-small cell lung cancer.
24481818 2014 Regulation of Src trafficking and activation by the endocytic regulatory proteins MICAL-L1 and EHD1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019528 2013 Differential roles of C-terminal Eps15 homology domain proteins as vesiculators and tubulators of recycling endosomes.
23596323 2013 Cooperation of MICAL-L1, syndapin2, and phosphatidic acid in tubular recycling endosome biogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22456504 2012 cPLA2? and EHD1 interact and regulate the vesiculation of cholesterol-rich, GPI-anchored, protein-containing endosomes.
22284051 2012 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20961375 2011 Pre-sorting endosomal transport of the GPI-anchored protein, CD59, is regulated by EHD1.
20801876 2010 Collapsin response mediator protein-2 (Crmp2) regulates trafficking by linking endocytic regulatory proteins to dynein motors.
20489164 2010 EH domain proteins regulate cardiac membrane protein targeting.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20106972 2010 Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19864458 2009 MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling.
19798736 2009 Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369419 2009 Eps15 homology domain 1-associated tubules contain phosphatidylinositol-4-phosphate and phosphatidylinositol-(4,5)-bisphosphate and are required for efficient recycling.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18661112 2008 EHDS are serine phosphoproteins: EHD1 phosphorylation is enhanced by serum stimulation.
18331452 2008 A role for EHD4 in the regulation of early endosomal transport.
17899392 2007 EH domain of EHD1.
17507647 2007 Myosin Vb interacts with Rab8a on a tubular network containing EHD1 and EHD3.
17284518 2007 EHD1 regulates beta1 integrin endosomal transport: effects on focal adhesions, cell spreading and migration.
17233914 2007 Shared as well as distinct roles of EHD proteins revealed by biochemical and functional comparisons in mammalian cells and C. elegans.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16251358 2006 Interactions between EHD proteins and Rab11-FIP2: a role for EHD3 in early endosomal transport.
15710626 2005 ATP binding regulates oligomerization and endosome association of RME-1 family proteins.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371016 Mutually exclusive interactions of EHD1 with GS32 and syndapin II.
15247266 2004 Role of EHD1 and EHBP1 in perinuclear sorting and insulin-regulated GLUT4 recycling in 3T3-L1 adipocytes.
15020713 2004 Rabenosyn-5 and EHD1 interact and sequentially regulate protein recycling to the plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121420 2002 EHD3: a protein that resides in recycling tubular and vesicular membrane structures and interacts with EHD1.
12032069 2002 A tubular EHD1-containing compartment involved in the recycling of major histocompatibility complex class I molecules to the plasma membrane.
11423532 2001 Association of insulin-like growth factor 1 receptor with EHD1 and SNAP29.
10673336 2000 EHD2, EHD3, and EHD4 encode novel members of a highly conserved family of EH domain-containing proteins.
10564830 1999 Evaluation and molecular characterization of EHD1, a candidate gene for Bardet-Biedl syndrome 1 (BBS1).
10395801 1999 EHD1--an EH-domain-containing protein with a specific expression pattern.
9397678 1997 EH: a novel protein-protein interaction domain potentially involved in intracellular sorting.
9253601 1997 A transcript map for the 2.8-Mb region containing the multiple endocrine neoplasia type 1 locus.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.