Property Summary

NCBI Gene PubMed Count 51
Grant Count 104
R01 Count 52
Funding $27,815,053.22
PubMed Score 434.97
PubTator Score 89.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.700 0.001
osteosarcoma -1.501 0.000
posterior fossa group A ependymoma 1.500 0.000
glioblastoma 1.800 0.000
medulloblastoma, large-cell 1.100 0.003
tuberculosis and treatment for 6 months -1.500 0.000
primary pancreatic ductal adenocarcinoma 1.326 0.005
lung cancer -1.400 0.023
pancreatic cancer 1.200 0.005
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.100 0.001
aldosterone-producing adenoma -1.097 0.032
Polycystic Ovary Syndrome -1.031 0.005
lung carcinoma -1.200 0.000
gastric carcinoma 1.200 0.043
ulcerative colitis 1.200 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9H4M9 O14611 Q2M3Q4 Q9UNR3
Symbols PAST
PAST1
H-PAST
HPAST1

Gene

PDB

2JQ6   2KFF   2KFG   2KFH   2KSP  

Gene RIF (22)

PMID Text
26465136 van der Waals interactions should be the main consideration when we design peptide inhibitors of EHD1 EH domain with high affinities.
26378252 Authors found that Eps15-homology domain 1 (EHD1), a protein that associates with the endocytic recycling compartment (ERC), colocalizes with active R-Ras in transiently expressed HeLa cells.
25595798 Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.
25287187 that Molecule Interacting with CasL Like-1 and Eps15 Homology Domain protein 1 differentially influence microtubule dynamics during early and late mitosis
24946721 Data indicate that concordant transforming growth factor-beta1 (TGFbeta-1) positive and EH-domain containing 1 (EHD1) negative as a strong favorable prognosis factor in non-small cell lung cancer (NSCLC).
24481818 MICAL-L1-mediated recruitment of EHD1 to Src-containing recycling endosomes is required for the release of Src from the perinuclear endocytic recycling compartment in response to growth factor stimulation.
24019528 evidence that the functions of both EHD1 and EHD4 are primarily in TRE membrane vesiculation, whereas EHD3 is a membrane-tubulating protein.
22456504 the lipid modifier cPLA2alpha and EHD1 are involved in the vesiculation of CD59-containing endosomes
22284051 Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function
20961375 EHD1 is involved in the control of CD59 transport from pre-sorting endosomes to the ERC in a PKC-dependent manner
More...

AA Sequence

MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG      1 - 70
KTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQ     71 - 140
LPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH    141 - 210
EDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFK    211 - 280
DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISP    281 - 350
GDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG    351 - 420
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADV    421 - 490
DKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE                              491 - 534
//

Text Mined References (65)

PMID Year Title
27189942 2016 EHD3 Protein Is Required for Tubular Recycling Endosome Stabilization, and an Asparagine-Glutamic Acid Residue Pair within Its Eps15 Homology (EH) Domain Dictates Its Selective Binding to NPF Peptides.
26465136 2015 Molecular dynamics simulation of the interactions between EHD1 EH domain and multiple peptides.
26378252 2015 ARF-GEF cytohesin-2/ARNO regulates R-Ras and ?5-integrin recycling through an EHD1-positive compartment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686250 2015 Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
25595798 2015 Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25287187 2015 Novel functions for the endocytic regulatory proteins MICAL-L1 and EHD1 in mitosis.
24946721 2014 Expression of TGF?-1 and EHD1 correlated with survival of non-small cell lung cancer.
24481818 2014 Regulation of Src trafficking and activation by the endocytic regulatory proteins MICAL-L1 and EHD1.
More...