Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.25
PubTator Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.300 9.8e-04
Astrocytoma, Pilocytic 2.400 3.3e-10
atypical teratoid / rhabdoid tumor 1.500 1.2e-03
ependymoma 1.800 4.0e-09
glioblastoma 1.400 9.2e-06
inflammatory breast cancer -1.400 2.0e-02
subependymal giant cell astrocytoma 1.687 8.1e-03

AA Sequence

MEGSRPRSSLSLASSASTISSLSSLSPKKPTRAVNKIHAFGKRGNALRRDPNLPVHIRGWLHKQDSSGLR      1 - 70
LWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLED     71 - 140
LRGWLRALGRASRAEGDDYGQPRSPARPQPGEGPGGPGGPPEVSRGEEGRISESPEVTRLSRGRGRPRLL    141 - 210
TPSPTTDLHSGLQMRRARSPDLFTPLSRPPSPLSLPRPRSAPARRPPAPSGDTAPPARPHTPLSRIDVRP    211 - 280
PLDWGPQRQTLSRPPTPRRGPPSEAGGGKPPRSPQHWSQEPRTQAHSGSPTYLQLPPRPPGTRASMVLLP    281 - 350
GPPLESTFHQSLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQATREAGAPGRAW    351 - 420
GRQRLLQDRLVSVRATLCHLTQERERVWDTYSGLEQELGTLRETLEYLLHLGSPQDRVSAQQQLWMVEDT    421 - 490
LAGLGGPQKPPPHTEPDSPSPVLQGEESSERESLPESLELSSPRSPETDWGRPPGGDKDLASPHLGLGSP    491 - 560
RVSRASSPEGRHLPSPQLGTKAPVARPRMSAQEQLERMRRNQECGRPFPRPTSPRLLTLGRTLSPARRQP    561 - 630
DVEQRPVVGHSGAQKWLRSSGSWSSPRNTTPYLPTSEGHRERVLSLSQALATEASQWHRMMTGGNLDSQG    631 - 700
DPLPGVPLPPSDPTRQETPPPRSPPVANSGSTGFSRRGSGRGGGPTPWGPAWDAGIAPPVLPQDEGAWPL    701 - 770
RVTLLQSSF                                                                 771 - 779
//

Text Mined References (6)

PMID Year Title