Property Summary

NCBI Gene PubMed Count 25
PubMed Score 6.78
PubTator Score 10.37

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Process (1)

Gene RIF (8)

PMID Text
26812496 It indicates that VAPB along with ORP3 plays a central role in maintenance of the intracellular PtdIns4P gradient.
25447204 phosphorylation of ORP3 controls its association with VAPA. Furthermore, ORP3-VAPA complexes stimulate R-Ras signaling.
22190034 HIV-1 PR is identified to have a physical interaction with oxysterol binding protein-like 3 (OSBPL3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with oxysterol binding protein-like 3 (OSBPL3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18854154 Knockdown of oxysterol binding protein-like 3 (OSBPL3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18270267 The present findings demonstrate a new function of ORP3 as part of the machinery that controls the actin cytoskeleton, cell polarity and cell adhesion.
16143324 The intracellular targeting determinants of oxysterol binding protein (OSBP)-related protein 3 (ORP3) were studied using a series of truncated and point mutated constructs.

AA Sequence

MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWH      1 - 70
KRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSK     71 - 140
LRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVP    141 - 210
LWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRA    211 - 280
IGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA    281 - 350
FNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNL    351 - 420
AEENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNLSND    421 - 490
LDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLC    491 - 560
EELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYECIREDKGFQFFSEQVS    561 - 630
HHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWI    631 - 700
EHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVW    701 - 770
RANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERR    771 - 840
RVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW                           841 - 887
//

Text Mined References (35)

PMID Year Title
26812496 2016 Oxysterol-binding protein ORP3 rescues the Amyotrophic Lateral Sclerosis-linked mutant VAPB phenotype.
25447204 2015 OSBP-related protein 3 (ORP3) coupling with VAMP-associated protein A regulates R-Ras activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23830809 2013 Oxysterol-binding proteins: sterol and phosphoinositide sensors coordinating transport, signaling and metabolism.
23428468 2013 Oxysterol-binding proteins: functions in cell regulation beyond lipid metabolism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028956 2012 OSBP-related proteins (ORPs) in human adipose depots and cultured adipocytes: evidence for impacts on the adipocyte phenotype.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...