Property Summary

NCBI Gene PubMed Count 25
PubMed Score 7.14
PubTator Score 10.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis 1.733 1.3e-02
adult high grade glioma 1.300 6.4e-03
astrocytoma 2.200 1.5e-02
chronic rhinosinusitis -1.033 2.1e-02
colon cancer 1.100 9.2e-03
cutaneous lupus erythematosus 1.200 2.6e-03
cystic fibrosis 1.001 7.6e-05
ductal carcinoma in situ 1.100 3.5e-03
gastric carcinoma 1.500 5.2e-03
glioblastoma 1.200 7.7e-03
interstitial cystitis 1.700 2.5e-03
intraductal papillary-mucinous adenoma (... 3.000 8.9e-05
intraductal papillary-mucinous carcinoma... 2.700 3.4e-04
intraductal papillary-mucinous neoplasm ... 3.300 1.4e-03
invasive ductal carcinoma 1.432 5.9e-04
lung cancer -1.700 1.8e-04
lung carcinoma -1.800 1.8e-18
ovarian cancer 1.400 1.3e-04
pancreatic cancer 1.700 1.6e-05
pancreatic ductal adenocarcinoma liver m... 1.758 2.5e-02
primary Sjogren syndrome 1.500 5.1e-04
psoriasis 1.800 4.9e-04
subependymal giant cell astrocytoma 3.452 4.3e-03

Gene RIF (7)

AA Sequence

MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWH      1 - 70
KRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSK     71 - 140
LRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVP    141 - 210
LWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRA    211 - 280
IGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA    281 - 350
FNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNL    351 - 420
AEENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNLSND    421 - 490
LDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLC    491 - 560
EELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYECIREDKGFQFFSEQVS    561 - 630
HHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWI    631 - 700
EHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVW    701 - 770
RANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERR    771 - 840
RVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW                           841 - 887
//

Text Mined References (35)

PMID Year Title