Property Summary

NCBI Gene PubMed Count 43
Grant Count 22
R01 Count 17
Funding $3,083,846.73
PubMed Score 68.59
PubTator Score 26.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Waterhouse-Friderichsen syndrome 11 3.745 1.9

Expression

Gene RIF (23)

PMID Text
26511642 High SENP3 expression is associated with stomach neoplasms.
25288641 Evidence show that mTOR-mediated phosphorylation of SENP3 facilitates the interaction with NPM1, thereby promoting nucleolar targeting.
25216525 SENP3, which is increased in gastric cancer cells, potentiates the transcriptional activity of FOXC2 through de-SUMOylation, in favor of the induction of specific mesenchymal gene expression in gastric cancer metastasis.
24930734 SENP3 is associated with MLL1/MLL2 complexes and catalyzes deSUMOylation of RbBP5.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of SUMO1/sentrin/SMT3 specific peptidase 3 (SENP3) expression as compared to untreated control
23524851 In a novel adaptive pathway to extreme cell stress, dynamic changes in SENP3 stability and regulation of Drp1 SUMOylation are crucial determinants of cell fate.
23467634 ROS induced SENP3 redistribution from the nucleoli to the nucleoplasm.
22684029 The shift of HIF-1 transactivation by reactive oxidative species is correlated with and dependent on the biphasic redox sensing of SENP3 that leads to the differential SENP3/p300 interaction and the consequent fluctuation in the p300 SUMOylation status.
21316347 These results suggest that SMT3IP1 is a new regulator of the p53-Mdm2 pathway.
20924358 Hsp90/SENP3 association protects SENP3 from CHIP-mediated ubiquitination and subsequent degradation, but this effect of Hsp90 requires the presence of CHIP.
More...

AA Sequence

MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSF      1 - 70
DASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSK     71 - 140
STSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVR    141 - 210
GSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHV    211 - 280
AQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQE    281 - 350
FSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPE    351 - 420
KVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRR    421 - 490
CPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLR    491 - 560
RQIYKELCHCKLTV                                                            561 - 574
//

Text Mined References (49)

PMID Year Title
26511642 2016 SENP3 regulates the global protein turnover and the Sp1 level via antagonizing SUMO2/3-targeted ubiquitination and degradation.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25288641 2014 mTOR signaling regulates nucleolar targeting of the SUMO-specific isopeptidase SENP3.
25216525 2014 De-SUMOylation of FOXC2 by SENP3 promotes the epithelial-mesenchymal transition in gastric cancer cells.
24930734 2014 The SUMO-specific isopeptidase SENP3 regulates MLL1/MLL2 methyltransferase complexes and controls osteogenic differentiation.
23524851 2013 SENP3-mediated deSUMOylation of dynamin-related protein 1 promotes cell death following ischaemia.
23467634 2013 Overexpression of SENP3 in oral squamous cell carcinoma and its association with differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118916 2012 Genome-wide scan identifies variant in TNFSF13 associated with serum IgM in a healthy Chinese male population.
22872859 2012 Five friends of methylated chromatin target of protein-arginine-methyltransferase[prmt]-1 (chtop), a complex linking arginine methylation to desumoylation.
More...