Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.08
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.512 0.000
posterior fossa group B ependymoma 1.300 0.000
tuberculosis and treatment for 6 months -1.100 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q9H4K7 A6NDR3 B4DR85 Q96I17 Q9NVG9 Q9UFR4
Symbols ObgH1
GTPBP5
dJ1005F21.2

Gene

Gene RIF (4)

PMID Text
23396448 The results suggested that ObgH1 functions with the large subunit of the mitochondrial ribosome, and are involved in both the translation and assembly of respiratory complexes.
21608104 GTPBP5 bears further study as a cause of TEF/EA accompanied by other malformations.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17054726 Knock-down of ObgH1 by RNAi induced mitochondria elongation, whereas knock-down of ObgH2 resulted in the disorganization of the nucleolar architecture.

AA Sequence

MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKR      1 - 70
YFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDG     71 - 140
GSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQ    141 - 210
PGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIP    211 - 280
GIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLP    281 - 350
EAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW                  351 - 406
//

Text Mined References (12)

PMID Year Title
23396448 2013 Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes.
21608104 2011 De novo deletion of chromosome 20q13.33 in a patient with tracheo-esophageal fistula, cardiac defects and genitourinary anomalies implicates GTPBP5 as a candidate gene.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17054726 2006 Human small G proteins, ObgH1, and ObgH2, participate in the maintenance of mitochondria and nucleolar architectures.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...