Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.08
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 2.1e-10
osteosarcoma 7950 1.2e-05
tuberculosis and treatment for 6 months 409 4.1e-05
ovarian cancer 8520 1.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Esophageal atresia 43 4.439 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.200 2.1e-10
osteosarcoma 1.512 1.2e-05
ovarian cancer 1.400 1.9e-04
tuberculosis and treatment for 6 months -1.100 4.1e-05

Gene RIF (4)

AA Sequence

MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKR      1 - 70
YFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDG     71 - 140
GSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQ    141 - 210
PGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIP    211 - 280
GIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLP    281 - 350
EAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW                  351 - 406
//

Text Mined References (12)

PMID Year Title