Property Summary

NCBI Gene PubMed Count 10
Grant Count 12
Funding $8,746,250.5
PubMed Score 34.11
PubTator Score 9.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 3.500 0.000
nasopharyngeal carcinoma -1.300 0.000

AA Sequence

MRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGM      1 - 70
QKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKA     71 - 140
VCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQ    141 - 210
EQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKE    211 - 280
QHLQKKYMNEVYTNQPTGDYFTQFNTGSR                                             281 - 309
//

Text Mined References (11)

PMID Year Title
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21630459 2011 Proteomic characterization of the human sperm nucleus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15563848 2004 Genomic structure and expression analysis of the mouse testis-specific ribbon protein (Trib) gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...