Property Summary

NCBI Gene PubMed Count 10
PubMed Score 39.36
PubTator Score 9.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.7e-09
ependymoma 4679 5.5e-08
Disease Target Count Z-score Confidence
Necrotizing fasciitis 10 3.175 1.6
Myelomeningocele 16 3.084 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 2.300 5.5e-08
nasopharyngeal carcinoma -1.300 1.7e-09

AA Sequence

MRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGM      1 - 70
QKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKA     71 - 140
VCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQ    141 - 210
EQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKE    211 - 280
QHLQKKYMNEVYTNQPTGDYFTQFNTGSR                                             281 - 309
//

Text Mined References (11)

PMID Year Title