Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.61
PubTator Score 3.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.600 2.3e-02
atypical teratoid / rhabdoid tumor -1.200 1.8e-04
breast carcinoma -1.200 2.0e-07
cutaneous lupus erythematosus -1.200 1.0e-02
invasive ductal carcinoma -1.400 1.5e-03
lung adenocarcinoma -1.400 2.3e-12
lung cancer -1.200 2.3e-02
malignant mesothelioma -1.400 2.1e-06
medulloblastoma, large-cell -1.300 1.3e-04
osteosarcoma -1.168 1.6e-02
psoriasis -1.300 7.0e-04
sonic hedgehog group medulloblastoma -1.100 2.3e-04

Gene RIF (4)

AA Sequence

MASKRKSTTPCMIPVKTVVLQDASMEAQPAETLPEGPQQDLPPEASAASSEAAQNPSSTDGSTLANGHRS      1 - 70
TLDGYLYSCKYCDFRSHDMTQFVGHMNSEHTDFNKDPTFVCSGCSFLAKTPEGLSLHNATCHSGEASFVW     71 - 140
NVAKPDNHVVVEQSIPESTSTPDLAGEPSAEGADGQAEIIITKTPIMKIMKGKAEAKKIHTLKENVPSQP    141 - 210
VGEALPKLSTGEMEVREGDHSFINGAVPVSQASASSAKNPHAANGPLIGTVPVLPAGIAQFLSLQQQPPV    211 - 280
HAQHHVHQPLPTAKALPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKI    281 - 350
WFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEG    351 - 420
TGGGLLVTQPLMANGLQATSSPLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLLTACPSITSQA    421 - 490
FLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMIP    491 - 560
GDHSSIIIDSVPEVSFSPSSKVPEVTCIPTTATLATHPSAKRQSWHQTPDFTPTKYKERAPEQLRALESS    561 - 630
FAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLASEL    631 - 700
RVSGENGSLEMPSSHILAERKVSPIKINLKNLRVTEANGRNEIPGLGACDPEDDESNKLAEQLPGKVSCK    701 - 770
KTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLL    771 - 840
VIAPGNRELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELT    841 - 910
AVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLETD                            911 - 956
//

Text Mined References (26)

PMID Year Title