Property Summary

NCBI Gene PubMed Count 18
Grant Count 7
R01 Count 6
Funding $391,413.75
PubMed Score 3.61
PubTator Score 3.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
cutaneous lupus erythematosus -1.200 0.010
psoriasis -1.300 0.001
osteosarcoma -1.168 0.016
astrocytoma 1.600 0.023
atypical teratoid/rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.300 0.000
lung cancer -1.200 0.023
breast carcinoma -1.200 0.000
sonic hedgehog group medulloblastoma -1.100 0.000
lung adenocarcinoma -1.400 0.000
invasive ductal carcinoma -1.400 0.001

Gene RIF (3)

PMID Text
21174497 ZHX3 is involved in the switch from the undifferentiated state of mesenchymal stem cells to an osteogenic program
17056598 ZHX proteins 1, 2 and 3 are major transcriptional mediators of podocyte disease
12659632 dimerizes with both ZHX1 and ZHX3, also interacts with the activation domain of the NF-YA

AA Sequence

MASKRKSTTPCMIPVKTVVLQDASMEAQPAETLPEGPQQDLPPEASAASSEAAQNPSSTDGSTLANGHRS      1 - 70
TLDGYLYSCKYCDFRSHDMTQFVGHMNSEHTDFNKDPTFVCSGCSFLAKTPEGLSLHNATCHSGEASFVW     71 - 140
NVAKPDNHVVVEQSIPESTSTPDLAGEPSAEGADGQAEIIITKTPIMKIMKGKAEAKKIHTLKENVPSQP    141 - 210
VGEALPKLSTGEMEVREGDHSFINGAVPVSQASASSAKNPHAANGPLIGTVPVLPAGIAQFLSLQQQPPV    211 - 280
HAQHHVHQPLPTAKALPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKI    281 - 350
WFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEG    351 - 420
TGGGLLVTQPLMANGLQATSSPLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLLTACPSITSQA    421 - 490
FLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMIP    491 - 560
GDHSSIIIDSVPEVSFSPSSKVPEVTCIPTTATLATHPSAKRQSWHQTPDFTPTKYKERAPEQLRALESS    561 - 630
FAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLASEL    631 - 700
RVSGENGSLEMPSSHILAERKVSPIKINLKNLRVTEANGRNEIPGLGACDPEDDESNKLAEQLPGKVSCK    701 - 770
KTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLL    771 - 840
VIAPGNRELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELT    841 - 910
AVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLETD                            911 - 956
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21174497 2011 Impact of zinc fingers and homeoboxes 3 on the regulation of mesenchymal stem cell osteogenic differentiation.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...