Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.44
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Multiple Sclerosis 498 1.0

Expression

Synonym

Accession Q9H4I0 B2RXL0 B7ZBB1 B7ZW76 Q5W0X5
Symbols RAD21L
dJ545L17.2

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
21527826 RAD21L is identified as a novel cohesin complex subunit homologous to mammalian RAD21/REC8/alpha-kleisin subfamily.

AA Sequence

MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIEKILSPKVKIALRTSGHLLLGVVRIYNRK      1 - 70
AKYLLADCSEAFLKMKMTFCPGLVDLPKENFEASYNAITLPEEFHDFDTQNMNAIDVSEHFTQNQSRPEE     71 - 140
ITLRENFDNDLIFQAESFGEESEILRRHSFFDDNILLNSSGPLIEHSSGSLTGERSLFYDSGDGFGDEGA    141 - 210
AGEMIDNLLQDDQNILLEDMHLNREISLPSEPPNSLAVEPDNSECICVPENEKMNETILLSTEEEGFTLD    211 - 280
PIDISDIAEKRKGKKRRLLIDPIKELSSKVIHKQLTSFADTLMVLELAPPTQRLMMWKKRGGVHTLLSTA    281 - 350
AQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIGG    351 - 420
SQHSSHEDTNKNINSEQDIVEMVSLAAEESSLMNDLFAQEIEYSPVELESLSNEENIETERWNGRILQML    421 - 490
NRLRESNKMGMQSFSLMKLCRNSDRKQAAAKFYSFLVLKKQLAIELSQSAPYADIIATMGPMFYNI        491 - 556
//

Text Mined References (6)

PMID Year Title
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
21527826 2011 Identification and molecular characterization of the mammalian ?-kleisin RAD21L.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.