Property Summary

NCBI Gene PubMed Count 5
PubMed Score 12.07
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Multiple Sclerosis 527 0.0 1.8
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 35 3.803 1.9
Azoospermia 106 3.718 1.9

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIEKILSPKVKIALRTSGHLLLGVVRIYNRK      1 - 70
AKYLLADCSEAFLKMKMTFCPGLVDLPKENFEASYNAITLPEEFHDFDTQNMNAIDVSEHFTQNQSRPEE     71 - 140
ITLRENFDNDLIFQAESFGEESEILRRHSFFDDNILLNSSGPLIEHSSGSLTGERSLFYDSGDGFGDEGA    141 - 210
AGEMIDNLLQDDQNILLEDMHLNREISLPSEPPNSLAVEPDNSECICVPENEKMNETILLSTEEEGFTLD    211 - 280
PIDISDIAEKRKGKKRRLLIDPIKELSSKVIHKQLTSFADTLMVLELAPPTQRLMMWKKRGGVHTLLSTA    281 - 350
AQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIGG    351 - 420
SQHSSHEDTNKNINSEQDIVEMVSLAAEESSLMNDLFAQEIEYSPVELESLSNEENIETERWNGRILQML    421 - 490
NRLRESNKMGMQSFSLMKLCRNSDRKQAAAKFYSFLVLKKQLAIELSQSAPYADIIATMGPMFYNI        491 - 556
//

Text Mined References (6)

PMID Year Title