Property Summary

NCBI Gene PubMed Count 13
PubMed Score 39.42
PubTator Score 33.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 4.39231083910619E-35
psoriasis 6685 5.50037931082687E-27
non-small cell lung cancer 2798 1.18974856161702E-26
Breast cancer 3099 1.98431141579147E-15
atypical teratoid/rhabdoid tumor 1095 1.42144929941429E-8
ovarian cancer 8492 3.09078092370936E-8
glioblastoma 5572 8.8120595693981E-8
group 3 medulloblastoma 2254 2.56025455068667E-5
pediatric high grade glioma 2712 2.79269592150013E-5
invasive ductal carcinoma 2950 3.09416580339428E-5
lung adenocarcinoma 2714 3.92718525728098E-5
adrenocortical carcinoma 1427 4.55342656518608E-5
primitive neuroectodermal tumor 3031 5.09010492567489E-5
medulloblastoma, large-cell 6234 7.49874782991731E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.26245831198189E-4
ductal carcinoma in situ 1745 9.49086990020212E-4
interstitial cystitis 2299 0.00159066411714319
pancreatic cancer 2300 0.00174634831606921
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00175354427976508
posterior fossa group A ependymoma 1511 0.00329368981386131
head and neck cancer 270 0.00660337526279533
Atopic dermatitis 944 0.0077306116334911
chronic rhinosinusitis 512 0.0170803756468217
cystic fibrosis and chronic rhinosinusitis 213 0.0252453422986592
Endometriosis 535 0.0445559608959508
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

Synonym

Accession Q9H4H8 B4E1I7 Q5THR2 Q68EN1 Q6P457 Q7Z6H0 Q96DF5 Q96N89 Q9BVM8
Symbols CHICA
C20orf129
dJ616B8.3

Gene

PDB

5E0L   5E0M  

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
26652654 NMR-derived secondary chemical shifts and relaxation properties show that the Chica LC8 binding domain is essentially disordered with a dynamically restricted segment in one linker between motifs.
26125229 upregulation of FAM83D, a potential oncotarget gene, may be triggered by epigenetic events and can contribute to hepatocarcinogenesis
25646692 Taken together, these results demonstrate that FAM83D is a novel oncogene in HCC development and may constitute a potential therapeutic target in HCC.
24344117 Results demonstrate that FAM83D has prognostic value for breast cancer patients and is a novel oncogene in breast cancer development that at least in part acts through mTOR hyper-activation by inhibiting FBXW7.
18485706 interaction partner of the chromokinesin Kid that is required for the generation of polar ejection forces and chromosome congression

AA Sequence

MALLSEGLDEVPAACLSPCGPPNPTELFSESRRLALEELVAGGPEAFAAFLRRERLARFLNPDEVHAILR      1 - 70
AAERPGEEGAAAAAAAEDSFGSSHDCSSGTYFPEQSDLEPPLLELGWPAFYQGAYRGATRVETHFQPRGA     71 - 140
GEGGPYGCKDALRQQLRSAREVIAVVMDVFTDIDIFRDLQEICRKQGVAVYILLDQALLSQFLDMCMDLK    141 - 210
VHPEQEKLMTVRTITGNIYYARSGTKIIGKVHEKFTLIDGIRVATGSYSFTWTDGKLNSSNLVILSGQVV    211 - 280
EHFDLEFRILYAQSKPISPKLLSHFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEM    281 - 350
PAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAIDAATQTEPGEEMPGLSVSEVGTQTSITTACAGT    351 - 420
QTAVITRIASSQTTIWSRSTTTQTDMDENILFPRGTQSTEGSPVSKMSVSRSSSLKSSSSVSSQGSVASS    421 - 490
TGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHL    491 - 560
GLHSGNFSRVNLLAVRDVALYPSYQ                                                 561 - 585
//

Text Mined References (17)

PMID Year Title
26652654 2016 The Anchored Flexibility Model in LC8 Motif Recognition: Insights from the Chica Complex.
26125229 2015 Upregulation of FAM83D affects the proliferation and invasion of hepatocellular carcinoma.
25646692 2015 FAM83D activates the MEK/ERK signaling pathway and promotes cell proliferation in hepatocellular carcinoma.
24736947 2014 Conserved oncogenic behavior of the FAM83 family regulates MAPK signaling in human cancer.
24344117 2013 FAM83D promotes cell proliferation and motility by downregulating tumor suppressor gene FBXW7.
23205133 2012 Meta-analysis of the expression of the mitosis-related gene Fam83D.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18485706 2008 The spindle protein CHICA mediates localization of the chromokinesin Kid to the mitotic spindle.
More...