Property Summary

NCBI Gene PubMed Count 14
PubMed Score 45.11
PubTator Score 33.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma 2.824 4.6e-05
adult high grade glioma 1.300 1.0e-02
Atopic dermatitis 1.400 7.7e-03
atypical teratoid / rhabdoid tumor 1.800 1.4e-06
Breast cancer 3.200 2.0e-15
breast carcinoma 1.800 4.4e-35
chronic rhinosinusitis -1.868 1.7e-02
cystic fibrosis and chronic rhinosinusit... -1.952 2.5e-02
ductal carcinoma in situ 3.200 9.5e-04
Endometriosis 1.089 4.5e-02
ependymoma 1.100 9.8e-04
glioblastoma 2.100 8.8e-08
group 3 medulloblastoma 3.000 2.6e-05
head and neck cancer -1.800 6.6e-03
interstitial cystitis 2.300 2.3e-02
intraductal papillary-mucinous carcinoma... 2.500 9.3e-04
intraductal papillary-mucinous neoplasm ... 3.500 1.8e-03
invasive ductal carcinoma 4.000 3.1e-05
lung adenocarcinoma 1.200 3.9e-05
medulloblastoma, large-cell 2.400 7.5e-05
non-small cell lung cancer 3.674 1.2e-26
ovarian cancer 3.000 3.1e-08
pancreatic cancer 1.600 1.7e-03
primitive neuroectodermal tumor 2.200 5.1e-05
psoriasis 1.400 5.5e-27

Gene RIF (6)

AA Sequence

MALLSEGLDEVPAACLSPCGPPNPTELFSESRRLALEELVAGGPEAFAAFLRRERLARFLNPDEVHAILR      1 - 70
AAERPGEEGAAAAAAAEDSFGSSHDCSSGTYFPEQSDLEPPLLELGWPAFYQGAYRGATRVETHFQPRGA     71 - 140
GEGGPYGCKDALRQQLRSAREVIAVVMDVFTDIDIFRDLQEICRKQGVAVYILLDQALLSQFLDMCMDLK    141 - 210
VHPEQEKLMTVRTITGNIYYARSGTKIIGKVHEKFTLIDGIRVATGSYSFTWTDGKLNSSNLVILSGQVV    211 - 280
EHFDLEFRILYAQSKPISPKLLSHFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEM    281 - 350
PAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAIDAATQTEPGEEMPGLSVSEVGTQTSITTACAGT    351 - 420
QTAVITRIASSQTTIWSRSTTTQTDMDENILFPRGTQSTEGSPVSKMSVSRSSSLKSSSSVSSQGSVASS    421 - 490
TGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHL    491 - 560
GLHSGNFSRVNLLAVRDVALYPSYQ                                                 561 - 585
//

Text Mined References (18)

PMID Year Title