Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H4G8
Symbols DPH3B
ZCSL1
C20orf143

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MAVFHDEVEIEDFQYDEDSETYFCPCPCGDNFSITKEELENGEGVAMCPGCSLIIKVIYDKDQFACGETV      1 - 70
PVPSVNKE                                                                   71 - 78
//

Text Mined References (1)

PMID Year Title
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.