Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $1,145,096.34
PubMed Score 9.71
PubTator Score 10.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H4G4 Q5VZR1 Q8N2S6 Q8WWC9 Q8WX36 GAPR-1
Symbols GAPR1
GAPR-1
C9orf19

Gene

PANTHER Protein Class (1)

 Grant Application (2)

PDB

1SMB   4AIW  

Gene RIF (4)

PMID Text
24204846 Hypoxia promotes epithelial-mesenchymal transition of hepatocellular carcinoma cells via inducing GLIPR-2 expression.
23516513 GLIPR-2 overexpression in HK-2 cells can potentiate EMT-like processes in this cell type through the ERK1/2 signaling pathway
22560898 the charge properties of the lipid bilayer can regulate GAPR-1 dynamics as a potential mechanism to modulate GAPR-1 function
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA      1 - 70
SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV     71 - 140
NEGFFEENVLPPKK                                                            141 - 154
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24204846 2013 Hypoxia promotes epithelial--mesenchymal transition of hepatocellular carcinoma cells via inducing GLIPR-2 expression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23516513 2013 GLIPR-2 overexpression in HK-2 cells promotes cell EMT and migration through ERK1/2 activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22560898 2012 Interaction of GAPR-1 with lipid bilayers is regulated by alternative homodimerization.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
More...