Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.71
PubTator Score 10.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.89132688475523E-37
non-small cell lung cancer 2798 6.15114542069458E-27
astrocytoma 1493 6.96130247606511E-19
oligodendroglioma 2849 3.93134607385487E-10
lung adenocarcinoma 2714 7.9768526365697E-10
posterior fossa group A ependymoma 1511 4.52715465077349E-8
chronic lymphosyte leukemia 232 1.60250967137953E-7
cystic fibrosis 1670 3.12661544583054E-7
tuberculosis 1563 3.94898957333112E-6
pediatric high grade glioma 2712 1.84292794217786E-5
ovarian cancer 8492 2.14393170158758E-5
pilocytic astrocytoma 3086 8.36618313416098E-5
glioblastoma 5572 1.36932902201576E-4
Breast cancer 3099 2.90635559582193E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.56922725569569E-4
interstitial cystitis 2299 3.99129582513633E-4
pancreatic cancer 2300 0.00122040574048803
osteosarcoma 7933 0.00203128350242139
primary pancreatic ductal adenocarcinoma 1271 0.00263961803846597
active ulcerative colitis 477 0.00637606559067656
Hydrolethalus syndrome 128 0.00729038383256178
progressive supranuclear palsy 674 0.00761553874619414
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0127276292278499
aldosterone-producing adenoma 664 0.0187012673476465
Polycystic Ovary Syndrome 335 0.0332984327658665
Disease Target Count Z-score Confidence
Alexander disease 9 3.464 1.7
Chikungunya 12 3.075 1.5

Expression

Synonym

Accession Q9H4G4 Q5VZR1 Q8N2S6 Q8WWC9 Q8WX36 GAPR-1
Symbols GAPR1
GAPR-1
C9orf19

Gene

PANTHER Protein Class (1)

PDB

1SMB   4AIW  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (4)

PMID Text
24204846 Hypoxia promotes epithelial-mesenchymal transition of hepatocellular carcinoma cells via inducing GLIPR-2 expression.
23516513 GLIPR-2 overexpression in HK-2 cells can potentiate EMT-like processes in this cell type through the ERK1/2 signaling pathway
22560898 the charge properties of the lipid bilayer can regulate GAPR-1 dynamics as a potential mechanism to modulate GAPR-1 function
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA      1 - 70
SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV     71 - 140
NEGFFEENVLPPKK                                                            141 - 154
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24204846 2013 Hypoxia promotes epithelial--mesenchymal transition of hepatocellular carcinoma cells via inducing GLIPR-2 expression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23516513 2013 GLIPR-2 overexpression in HK-2 cells promotes cell EMT and migration through ERK1/2 activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22560898 2012 Interaction of GAPR-1 with lipid bilayers is regulated by alternative homodimerization.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
More...