Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.03
PubTator Score 10.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -2.009 9.4e-03
adult high grade glioma 1.100 1.6e-02
aldosterone-producing adenoma -1.009 1.9e-02
astrocytoma 1.500 7.0e-19
Astrocytoma, Pilocytic 1.100 6.1e-04
Breast cancer -1.200 2.9e-04
chronic lymphosyte leukemia -1.300 1.6e-07
cystic fibrosis -2.675 2.3e-07
ependymoma 1.200 4.1e-05
glioblastoma 1.100 2.0e-04
Hydrolethalus syndrome -1.201 2.9e-02
interstitial cystitis 1.200 3.5e-03
intraductal papillary-mucinous carcinoma... -2.100 3.6e-04
intraductal papillary-mucinous neoplasm ... -1.600 1.3e-02
lung adenocarcinoma -1.500 9.7e-11
lung carcinoma -3.400 3.9e-37
non-small cell lung cancer -2.326 8.3e-29
oligodendroglioma 1.400 3.9e-10
osteosarcoma -1.939 2.0e-03
ovarian cancer 1.800 2.1e-05
pancreatic cancer 1.500 1.2e-03
Polycystic ovary syndrome -1.133 3.3e-02
primary pancreatic ductal adenocarcinoma 1.258 2.6e-03
progressive supranuclear palsy -1.100 7.6e-03
tuberculosis 1.200 3.9e-06

Gene RIF (6)

AA Sequence

MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA      1 - 70
SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV     71 - 140
NEGFFEENVLPPKK                                                            141 - 154
//

Text Mined References (22)

PMID Year Title