Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.06
PubTator Score 4.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Borderline personality disorder 12 4.378 2.2

Gene RIF (3)

PMID Text
20565543 We show with phylogenetic relations that the CTES genes are clustered into three original groups, a testatin, a Cres, and a CstL1 group
18976975 Knockdown of cystatin 9-like (CST9L) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
11756564 Results describe the sequence, genomic structure, chromosomal location, and expression pattern of the human testatin gene.

AA Sequence

MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL      1 - 70
GHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTFTCFFTISTRPWMTQFSLLNK     71 - 140
TCLEGFH                                                                   141 - 147
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
17903292 2007 A genome-wide association for kidney function and endocrine-related traits in the NHLBI's Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12644294 2003 A new subgroup of the family 2 cystatins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...