Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.88
PubTator Score 4.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (3)

AA Sequence

MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL      1 - 70
GHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTFTCFFTISTRPWMTQFSLLNK     71 - 140
TCLEGFH                                                                   141 - 147
//

Text Mined References (16)

PMID Year Title