Property Summary

NCBI Gene PubMed Count 37
PubMed Score 55.10
PubTator Score 16.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q9H4G0 O15046 Q4VXM6 Q4VXM7 Q4VXM8 Q4VXN4 Q6ZT61 Q8IUU7 Q96CV5 Q96L65
Symbols 4.1N
MRD11

Gene

Gene RIF (7)

PMID Text
26648170 the data of the current study identified 4.1N as an inhibitor of hypoxiainduced tumor progression in epithelial ovarian cancer cells.
26575790 Data suggest that repression of JNK-c-Jun signaling through pancreatic polypeptide receptor 1 (PP1) is one of the key anti-tumor mechanisms of neuronal membrane cytoskeletal protein 4.1 (4.1N).
23400781 Kainate receptor GluK2a post-translational modifications differentially regulate association with 4.1N to control activity-dependent receptor endocytosis
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20468064 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
12181426 protein 4.1N/dopamine receptor interaction is required for localization or stability of dopamine receptors at the neuronal plasma membrane.

AA Sequence

MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSE      1 - 70
ADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGL     71 - 140
TFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFV    141 - 210
THALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKL    211 - 280
SMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTI    281 - 350
GFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS    351 - 420
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKELKPEQETTP    421 - 490
RHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGL    491 - 560
REGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHG    561 - 630
SAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETM    631 - 700
TVSSLAIRKKIEPEAVLQTRVSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMI    701 - 770
PGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQ    771 - 840
ALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES                                 841 - 881
//

Text Mined References (43)

PMID Year Title
26648170 2016 4.1N suppresses hypoxia-induced epithelial-mesenchymal transition in epithelial ovarian cancer cells.
26575790 2016 Protein 4.1N acts as a potential tumor suppressor linking PP1 to JNK-c-Jun pathway regulation in NSCLC.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23994105 2013 Defective expression of Protein 4.1N is correlated to tumor progression, aggressive behaviors and chemotherapy resistance in epithelial ovarian cancer.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23400781 2013 Kainate receptor post-translational modifications differentially regulate association with 4.1N to control activity-dependent receptor endocytosis.
23256752 2013 The linoleic acid derivative DCP-LA increases membrane surface localization of the ?7 ACh receptor in a protein 4.1N-dependent manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...