Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.02
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVR      1 - 70
EPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYF     71 - 140
QKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSF    141 - 210
LSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEK    211 - 280
AVFSRWAKKRPIVFAHPSWRTE                                                    281 - 302
//

Text Mined References (16)

PMID Year Title