Property Summary

NCBI Gene PubMed Count 23
PubMed Score 137.70
PubTator Score 71.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lupus Erythematosus, Systemic 67 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.8e-06
invasive ductal carcinoma 2951 1.1e-02
spina bifida 1074 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma 1.100 1.1e-02
osteosarcoma -2.066 1.8e-06
spina bifida 1.029 4.8e-02

 IMPC Phenotype (1)

Gene RIF (14)

AA Sequence

MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMP      1 - 70
YLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPD     71 - 140
EVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVY    141 - 210
QELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCM    211 - 280
FCVKTANRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRL    281 - 350
QQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEE    351 - 420
AARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQE    421 - 490
KEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKR    491 - 560
PVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPE    561 - 630
N//

Text Mined References (29)

PMID Year Title