Property Summary

NCBI Gene PubMed Count 21
Grant Count 28
R01 Count 14
Funding $2,739,748.47
PubMed Score 122.11
PubTator Score 71.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -4.011 0.000
spina bifida 1.029 0.048
invasive ductal carcinoma 1.100 0.011

Gene RIF (12)

PMID Text
23088770 IBP was expressed ectopically in someoral squamous cell carcinoma samples and correlated significantly with tumor size, differentiation, clinical stage and distant metastases
22829599 DEF6, a novel substrate for the Tec kinase ITK, contains a glutamine-rich aggregation-prone region and forms cytoplasmic granules that co-localize with P-bodies.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19679060 Overexpression of the Interferon regulatory factor 4-binding protein is associated with Colorectal Carcinoma.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19393345 level of expression correlates with the degree of malignancy in breast carcinoma tissues
17121847 DEF6 not only activates Rho-family GTPases but also cooperates with activated Rac1 to exert its cellular function
15023524 DEF6, a novel PH-DH-like domain protein, is an upstream activator of the Rho GTPases Rac1, Cdc42, and RhoA.
More...

AA Sequence

MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMP      1 - 70
YLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPD     71 - 140
EVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVY    141 - 210
QELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCM    211 - 280
FCVKTANRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRL    281 - 350
QQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEE    351 - 420
AARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQE    421 - 490
KEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKR    491 - 560
PVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPE    561 - 630
N//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088770 2012 Ectopically expressed IBP promotes cell proliferation in oral squamous cell carcinoma.
22829599 2012 DEF6, a novel substrate for the Tec kinase ITK, contains a glutamine-rich aggregation-prone region and forms cytoplasmic granules that co-localize with P-bodies.
21269460 2011 Initial characterization of the human central proteome.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19946888 2010 Defining the membrane proteome of NK cells.
More...