Property Summary

NCBI Gene PubMed Count 23
PubMed Score 485.12
PubTator Score 55.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.100 1.4e-02
aldosterone-producing adenoma -1.055 9.7e-03
Astrocytoma, Pilocytic 1.100 1.8e-03
Breast cancer -2.400 1.0e-20
breast carcinoma -1.200 1.3e-05
cystic fibrosis -2.329 1.8e-06
ductal carcinoma in situ -1.100 1.8e-02
ependymoma 1.200 1.1e-04
glioblastoma 1.500 3.2e-04
intraductal papillary-mucinous adenoma (... -2.300 1.3e-04
intraductal papillary-mucinous carcinoma... -1.500 7.6e-03
intraductal papillary-mucinous neoplasm ... -1.400 5.0e-02
invasive ductal carcinoma -2.207 5.1e-04
lung adenocarcinoma -1.600 1.5e-14
lung carcinoma -1.500 3.5e-11
medulloblastoma, large-cell -1.300 1.9e-04
non-small cell lung cancer -1.703 1.9e-13
osteosarcoma 2.279 1.6e-04
pituitary cancer -1.200 2.2e-03
ulcerative colitis 1.100 4.8e-04

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL      1 - 70
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD     71 - 140
PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC    141 - 210
CSII                                                                      211 - 214
//

Text Mined References (23)

PMID Year Title