Property Summary

NCBI Gene PubMed Count 21
Grant Count 92
R01 Count 61
Funding $21,373,774.88
PubMed Score 453.31
PubTator Score 55.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H4E5 Q96KC1
Symbols TCL
ARHJ
TC10B
RASL7B

Gene

Gene RIF (10)

PMID Text
26299518 FMNL3 interacts with Cdc42 and RhoJ, two Rho family GTPases known to be required for lumen formation. FMNL3 and RhoJ are concentrated at the early apical surface, or AMIS, and regulate the formation of radiating actin cables from this site.
24928894 RhoJ-knockout mice showed reduced tumour growth and diminished tumour vessel density, identifying a role for RhoJ in mediating tumour angiogenesis. Studies give insight into the molecular function of RhoJ in regulating cell motility.
24434213 These results identify RhoJ blockade as a selective and effective therapeutic strategy for targeting tumor vasculature with minimal side effects.
23253891 These observations identify RHOJ as a melanoma linchpin determinant that regulates both actin cytoskeletal dynamics and chemoresistance by activating PAK1.
23029280 Arhgef15 acts as an endothelial cell-specific GEF to mediate VEGF-induced Cdc42 activation and potentiate RhoJ inactivation, thereby promoting actin polymerization and cell motility.
22971344 we identified RhoJ and its effector PAK1, as key modulators of melanoma cell sensitivity to DNA damage
21628409 Our study supports a novel role for the Rho family member RhoJ in ednothelial cell morphogenesis and in particular in lumen formation
21148427 RhoJ is endothelial-expressed in vivo, activated by vascular endothelial growth factor, localizes to focal adhesions, regulates endothelial cell migration and tube formation, and modulates actomyosin contractility and focal adhesion numbers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12960428 TCL is essential for clathrin-dependent endocytosed receptors to enter the early/sorting endosomes

AA Sequence

MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL      1 - 70
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD     71 - 140
PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC    141 - 210
CSII                                                                      211 - 214
//

Text Mined References (21)

PMID Year Title
26299518 2015 The Formin FMNL3 Controls Early Apical Specification in Endothelial Cells by Regulating the Polarized Trafficking of Podocalyxin.
25416956 2014 A proteome-scale map of the human interactome network.
24928894 2014 RhoJ interacts with the GIT-PIX complex and regulates focal adhesion disassembly.
24434213 2014 Vascular RhoJ is an effective and selective target for tumor angiogenesis and vascular disruption.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23253891 2013 RhoJ modulates melanoma invasion by altering actin cytoskeletal dynamics.
23029280 2012 Arhgef15 promotes retinal angiogenesis by mediating VEGF-induced Cdc42 activation and potentiating RhoJ inactivation in endothelial cells.
22971344 2012 RhoJ regulates melanoma chemoresistance by suppressing pathways that sense DNA damage.
22103495 2011 The role of RhoJ in endothelial cell biology and angiogenesis.
21628409 2011 RhoJ is an endothelial cell-restricted Rho GTPase that mediates vascular morphogenesis and is regulated by the transcription factor ERG.
More...