Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.97
PubTator Score 7.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 6.66598085342338E-22
lung adenocarcinoma 2714 6.92049328267815E-16
lung carcinoma 2844 3.96889474670139E-11
osteosarcoma 7933 6.94802918779262E-5
active ulcerative colitis 477 0.0236405029099375
mucosa-associated lymphoid tissue lymphoma 480 0.0286374249098585
spina bifida 1064 0.0427718280989518
Disease Target Count Z-score Confidence
Pelizaeus-Merzbacher disease 20 3.52 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.131 0.000
active ulcerative colitis 2.886 0.024
lung adenocarcinoma -1.500 0.000
lung carcinoma -2.200 0.000
non-small cell lung carcinoma -1.800 0.000
spina bifida -1.111 0.043
mucosa-associated lymphoid tissue lympho... 1.548 0.029

Synonym

Accession Q9H4D5 B4DYS7 Q5H9I1 Q9H1A9
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG

AA Sequence

MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYT      1 - 70
ISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVP     71 - 140
FVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAM    141 - 210
NQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCA    211 - 280
DRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ    281 - 350
QYYLIYDSGDRQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI    351 - 420
VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVND    421 - 490
KLFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKMLPS                                 491 - 531
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11566096 2001 NXF5, a novel member of the nuclear RNA export factor family, is lost in a male patient with a syndromic form of mental retardation.
More...