Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.82
PubTator Score 7.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis 2.886 2.4e-02
lung adenocarcinoma -1.200 1.5e-09
lung carcinoma -2.200 4.0e-11
mucosa-associated lymphoid tissue lympho... 1.548 2.9e-02
non-small cell lung carcinoma -1.800 6.7e-22
osteosarcoma -3.131 6.9e-05
spina bifida -1.111 4.3e-02

AA Sequence

MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYT      1 - 70
ISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVP     71 - 140
FVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAM    141 - 210
NQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCA    211 - 280
DRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ    281 - 350
QYYLIYDSGDRQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNIKILKDPYLRGELLKHTKLDI    351 - 420
VDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVND    421 - 490
KLFVRDTSHQGTQSALFTLVPTAFSSSVPAFSQEQQKMLPS                                 491 - 531
//

Text Mined References (12)

PMID Year Title