Property Summary

NCBI Gene PubMed Count 24
Grant Count 43
R01 Count 21
Funding $10,008,723.28
PubMed Score 61.13
PubTator Score 7.68

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (13)

PMID Text
26415670 Study did not find support for an association of KIBRA either alone or in combination with CLSTN2 with memory performance or hippocampal volume, nor did variation in these genes influence longitudinal memory decline or hippocampal atrophy in older adults
25080189 The results of this study supports the view that effects of KIBRA and CLSTN2 polymorphisms genetic polymorphisms on cognitive functioning may be most easily disclosed at suboptimal levels of cognitive ability, such as in old-age depression.
21643791 No increased risk of any type of late development, and cognitive impairment was associated with CLSTN2 (rs6439886)
20691427 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19804789 This study showed that the KIBRA and CLSTN2 genes interactively modulate episodic memory performance.
19606085 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19058786 calsyntenins play an essential role in learning and this role is modulated both by CLSTN2 genotype and, during adolescent development, by exposure to tobacco smoke.
More...

AA Sequence

MLPGRLCWVPLLLALGVGSGSGGGGDSRQRRLLAAKVNKHKPWIETSYHGVITENNDTVILDPPLVALDK      1 - 70
DAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETAWKK     71 - 140
SHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQVEAIDEDCSPQYSQICNYEIVTTDVPFAID    141 - 210
RNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF    211 - 280
PSIHLETCDGAVSSLQIVTELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVD    281 - 350
SSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHN    351 - 420
CRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSH    421 - 490
IAMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYH    491 - 560
FNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRRLKVSSKVQCFGEDVCISIPEVDAYVMVLQA    561 - 630
IEPRITLRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDIL    631 - 700
VIGGDLDPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIK    701 - 770
CSELNGRYTSNEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSSIQHSSVVPSIATVVIIIS    771 - 840
VCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVNPMEKHEGPGHGEDETEGEEEEEAE    841 - 910
EEMSSSSGSDDSEEEEEEEGMGRGRHGQNGARQAQLEWDDSTLPY                             911 - 955
//

Text Mined References (26)

PMID Year Title
26415670 2015 Investigating the influence of KIBRA and CLSTN2 genetic polymorphisms on cross-sectional and longitudinal measures of memory performance and hippocampal volume in older individuals.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25080189 2014 Interactive effects of KIBRA and CLSTN2 polymorphisms on episodic memory in old-age unipolar depression.
24920014 2014 A meta-analysis of Hodgkin lymphoma reveals 19p13.3 TCF3 as a novel susceptibility locus.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23472185 2013 Oligoclonal band status in Scandinavian multiple sclerosis patients is associated with specific genetic risk alleles.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21643791 2012 The role of memory-related gene polymorphisms, KIBRA and CLSTN2, on replicate memory assessment in the elderly.
More...