Property Summary

NCBI Gene PubMed Count 24
PubMed Score 61.13
PubTator Score 7.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung adenocarcinoma 2714 3.02646403332979E-12
astrocytoma 1493 3.63355915399319E-11
oligodendroglioma 2849 6.65985642420019E-9
psoriasis 6685 4.61932341828298E-8
Duchenne muscular dystrophy 602 8.38157862447844E-8
Breast cancer 3099 2.77928711828088E-5
sonic hedgehog group medulloblastoma 1482 1.32514375148768E-4
adult high grade glioma 2148 3.36571803407412E-4
ovarian cancer 8492 7.44521147797391E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00136852199924617
medulloblastoma, large-cell 6234 0.00314474457006479
Atopic dermatitis 944 0.00338363195877516
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00393831762275918
glioblastoma 5572 0.00463026891521936
ductal carcinoma in situ 1745 0.00528856510452855
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00543352564056476
pilocytic astrocytoma 3086 0.00799355454073107
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0111918011574663
primitive neuroectodermal tumor 3031 0.01728698286286
atypical teratoid / rhabdoid tumor 4369 0.0238592459483025
ependymoma 2514 0.0493676810699193
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Heart disease 279 0.0 1.0
Rheumatoid Arthritis 1171 0.0 2.0
Disease Target Count Z-score Confidence
Chondrosarcoma 24 5.86 2.9
Keratinizing squamous cell carcinoma 1 3.006 1.5

Expression

Synonym

Accession Q9H4D0 B2RCW5 D3DNF4 Q3SX54 Q3ZB76 Q5UE56 Q96HZ2 Q9BSS0
Symbols CS2
CSTN2
CDHR13
ALC-GAMMA
alcagamma

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (13)

PMID Text
26415670 Study did not find support for an association of KIBRA either alone or in combination with CLSTN2 with memory performance or hippocampal volume, nor did variation in these genes influence longitudinal memory decline or hippocampal atrophy in older adults
25080189 The results of this study supports the view that effects of KIBRA and CLSTN2 polymorphisms genetic polymorphisms on cognitive functioning may be most easily disclosed at suboptimal levels of cognitive ability, such as in old-age depression.
21643791 No increased risk of any type of late development, and cognitive impairment was associated with CLSTN2 (rs6439886)
20691427 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19804789 This study showed that the KIBRA and CLSTN2 genes interactively modulate episodic memory performance.
19606085 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19058786 calsyntenins play an essential role in learning and this role is modulated both by CLSTN2 genotype and, during adolescent development, by exposure to tobacco smoke.
More...

AA Sequence

MLPGRLCWVPLLLALGVGSGSGGGGDSRQRRLLAAKVNKHKPWIETSYHGVITENNDTVILDPPLVALDK      1 - 70
DAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETAWKK     71 - 140
SHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQVEAIDEDCSPQYSQICNYEIVTTDVPFAID    141 - 210
RNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF    211 - 280
PSIHLETCDGAVSSLQIVTELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVD    281 - 350
SSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHN    351 - 420
CRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSH    421 - 490
IAMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYH    491 - 560
FNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRRLKVSSKVQCFGEDVCISIPEVDAYVMVLQA    561 - 630
IEPRITLRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDIL    631 - 700
VIGGDLDPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIK    701 - 770
CSELNGRYTSNEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSSIQHSSVVPSIATVVIIIS    771 - 840
VCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVNPMEKHEGPGHGEDETEGEEEEEAE    841 - 910
EEMSSSSGSDDSEEEEEEEGMGRGRHGQNGARQAQLEWDDSTLPY                             911 - 955
//

Text Mined References (26)

PMID Year Title
26415670 2015 Investigating the influence of KIBRA and CLSTN2 genetic polymorphisms on cross-sectional and longitudinal measures of memory performance and hippocampal volume in older individuals.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25080189 2014 Interactive effects of KIBRA and CLSTN2 polymorphisms on episodic memory in old-age unipolar depression.
24920014 2014 A meta-analysis of Hodgkin lymphoma reveals 19p13.3 TCF3 as a novel susceptibility locus.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23472185 2013 Oligoclonal band status in Scandinavian multiple sclerosis patients is associated with specific genetic risk alleles.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21643791 2012 The role of memory-related gene polymorphisms, KIBRA and CLSTN2, on replicate memory assessment in the elderly.
More...