Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.89
PubTator Score 0.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung adenocarcinoma 2,713
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.536 0.000
lung adenocarcinoma 1.100 0.000

Gene RIF (2)

PMID Text
23867815 HIV-1 gp120-treated vaginal epithelial cells show downregulation of dipeptidase 3 (DPEP3) expression as compared to untreated control
12738806 This paper describes differences in substrate specificity and tissue distribution of membrane-bound dipeptidase 3 from mouse in comparison to other mouse members of this family.

AA Sequence

MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLT      1 - 70
TPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFW     71 - 140
SASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRS    141 - 210
FYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLE    211 - 280
VSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIG    281 - 350
SEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSP    351 - 420
VEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC      421 - 488
//

Text Mined References (9)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12738806 2003 Identification of two additional members of the membrane-bound dipeptidase family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.