Property Summary

NCBI Gene PubMed Count 34
PubMed Score 16.70
PubTator Score 13.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.100 0.026
hepatocellular carcinoma 1.100 0.034
pancreatic cancer 1.600 0.006
osteosarcoma -4.227 0.001
chronic lymphosyte leukemia -1.100 0.000
non-small cell lung cancer -1.208 0.000
pancreatic carcinoma 1.600 0.006
mucosa-associated lymphoid tissue lympho... 2.191 0.024

Synonym

Accession Q9H4B7
Symbols

Gene

Gene RIF (28)

PMID Text
26637975 Mutations in either TUBB or MAPRE2 cause circumferential skin creases Kunze type.
25529050 TUBB1 R307H SNP is significantly associated with the degree of thrombocytopenia in congenital and acquired platelet disorders, and may affect platelets by altering microtubule behavior.
24894670 Data indicate that ABCB1 protein, beta tubulin I and III (betaI, and betaIII tubulin) might contribute to the multidrug resistance (MDR) of MCF7/DOC and be potential therapeutic targets for overcoming MDR of breast cancer.
24344610 TUBB1 mutation disrupting microtubule assembly impairs proplatelet formation and results in congenital macrothrombocytopenia.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22805305 our findings define beta-tubulin VI as a hematologic isotype with significant genetic variation in humans that may affect the myelosuppresive action of microtubule-binding drugs
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21384078 homozygous status of P43 genetic polymorphism causes alterations in platelet ultrastructure
20532885 Observational study of gene-disease association. (HuGE Navigator)
20103599 human tumor cells can acquire spontaneous mutations in beta1-tubulin that cause resistance to paclitaxel
More...

AA Sequence

MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEP      1 - 70
GTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLG     71 - 140
GGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQ    211 - 280
YRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVK    281 - 350
VAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS    351 - 420
EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH                                           421 - 451
//

Text Mined References (38)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26637975 2015 Mutations in Either TUBB or MAPRE2 Cause Circumferential Skin Creases Kunze Type.
25529050 2015 ?-1 tubulin R307H SNP alters microtubule dynamics and affects severity of a hereditary thrombocytopenia.
24894670 2014 Association of ABCB1, ? tubulin I, and III with multidrug resistance of MCF7/DOC subline from breast cancer cell line MCF7.
24344610 2014 TUBB1 mutation disrupting microtubule assembly impairs proplatelet formation and results in congenital macrothrombocytopenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22805305 2012 Hematologic ?-tubulin VI isoform exhibits genetic variability that influences paclitaxel toxicity.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
More...