Property Summary

Ligand Count 31
NCBI Gene PubMed Count 37
PubMed Score 17.87
PubTator Score 13.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
chronic lymphosyte leukemia -1.100 4.3e-05
gastric cancer 1.100 2.6e-02
hepatocellular carcinoma 1.100 3.4e-02
mucosa-associated lymphoid tissue lympho... 2.191 2.4e-02
non-small cell lung cancer -1.208 1.7e-11
osteosarcoma -4.227 1.2e-03
pancreatic cancer 1.600 5.9e-03
pancreatic carcinoma 1.600 5.9e-03

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEP      1 - 70
GTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLG     71 - 140
GGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQ    211 - 280
YRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVK    281 - 350
VAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS    351 - 420
EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH                                           421 - 451
//

Text Mined References (41)

PMID Year Title