Property Summary

NCBI Gene PubMed Count 34
Grant Count 14
R01 Count 7
Funding $1,425,732.03
PubMed Score 63.28
PubTator Score 38.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (13)

PMID Text
25814670 using an Mst2 mutation that disrupts homotypic dimerization, we showed that the monomeric Mst2-SARAH domain could form a stable complex of 1:1 stoichiometric ratio with WW45 refolded under acidic pH.
25367221 MST1/2-SAV1 associates with the NPHP transition-zone complex, promoting ciliary localization of multiple ciliary cargoes.
23524264 Mst2 and the Ser-3 residue of human WW45 function independently of each other in the regulation of the stability of human WW45.
22570112 We also confirmed the interaction of HAX-1 and hSav1 in mammalian cells.
22185343 downregulation of SAV1 and the consequent YAP1 activation are involved in the pathogenesis of high-grade clear cell renal cell carcinoma.
21567072 hSav1 interacts with HAX1 and attenuates its protective role against apoptosis in MCF-7 breast cancer cells.
21489991 a role for Salvador as a human tumor suppressor and RASSF1A effector and show that Salvador allows RASSF1A to modulate p73 independently of the hippo pathway.
21104395 MST and hSAV act as novel co-regulators of ERalpha and may play an important role in breast cancer pathogenesis.
21076410 Study reports that two Hippo pathway components, Mst2 and the scaffold protein hSav1, directly interact with Nek2A and regulate its ability to localize to centrosomes, and phosphorylate C-Nap1 and rootletin.
19950692 hSav1 is a newly identified protein that interacts with Mst1 and augments Mst1-mediated apoptosis.
More...

AA Sequence

MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAFSTSGDVVSRN      1 - 70
QSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFF     71 - 140
DGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLPLPPGWSVDWT    141 - 210
MRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVT    211 - 280
YQPQQTERNQSLLVPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI    281 - 350
VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF                                         351 - 383
//

Text Mined References (37)

PMID Year Title
25814670 2015 Low pH-driven folding of WW45-SARAH domain leads to stabilization of the WW45-Mst2 complex.
25367221 2014 The MST1/2-SAV1 complex of the Hippo pathway promotes ciliogenesis.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23524264 2013 A conserved serine residue regulates the stability of Drosophila Salvador and human WW domain-containing adaptor 45 through proteasomal degradation.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23386615 2013 The tumor suppressor Mst1 promotes changes in the cellular redox state by phosphorylation and inactivation of peroxiredoxin-1 protein.
More...