Property Summary

NCBI Gene PubMed Count 56
Grant Count 77
R01 Count 48
Funding $7,227,592.47
PubMed Score 87.77
PubTator Score 115.11

Knowledge Summary

Patent (21,767)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.500 0.001
non-small cell lung cancer -1.331 0.000
lung carcinoma -1.600 0.000
Breast cancer -1.700 0.000

Synonym

Accession Q9H4B4 Q15767 Q5JR99 Q96CV1
Symbols CNK
FNK
PRK
PLK-3

Gene

PDB

4B6L  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (32)

PMID Text
26384350 Data suggest that HOXA-AS2 could be an oncogene for gastric cancer partly through suppressing P21, PLK3, and DDIT3 expression.
26352014 Plk3 is involved in the inhibition of cell proliferation and tumorigenesis, which may occur via interactions with p21.
25915845 The role of Plk3 in oncogenesis: the aberrant expression of Plk3 was found in different types of tumors.
25818805 PLK3 predominantly is expressed in Cholangiocarcinomas (CCA) cells and that high PLK3 expression correlates with prolonged overall survival.
25267294 Plk3 binds to CtIP phosphorylated at S327 via its Polo box domains, which is necessary for robust damage-induced CtIP phosphorylation at S327 and subsequent CtIP phosphorylation at T847.
25202016 hyperosmotic stress-activated Plk3 elicited gammaH2AX.
22828320 have identified and validated as in vitro PLK2 and PLK3 substrates HSP90, GRP-94, beta-tubulin, calumenin, and 14-3-3 epsilon
22549466 Here, the authors report phosphorylation of Thr4 by Polo-like kinase 3 in mammalian cells.
21840391 Bcl-xL phosphorylation at Ser49 by polo-like kinase 3 during cell cycle progression and checkpoints
21098032 hyperosmotic stress can activate the Plk3 signaling pathway that subsequently regulates the AP-1 complex by directly phosphorylating ATF-2 independent from the effects of JNK and p38 activation.
More...

AA Sequence

MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGRTYLKGRLLGK      1 - 70
GGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLE     71 - 140
LCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARL    141 - 210
EPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLP    211 - 280
ASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKS    281 - 350
LFGRKKKSKNHAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG    351 - 420
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFN    421 - 490
DGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAP    491 - 560
PLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLR    561 - 630
QRLRYALRLLRDRSPA                                                          631 - 646
//

Text Mined References (60)

PMID Year Title
26384350 2015 Long noncoding RNA HOXA-AS2 promotes gastric cancer proliferation by epigenetically silencing P21/PLK3/DDIT3 expression.
26352014 2015 Polo?like kinase 3 inhibits osteosarcoma cell proliferation and tumorigenesis via cooperative interaction with p21.
25915845 2016 The role of Plk3 in oncogenesis.
25818805 2015 Polo-like kinase 3 is associated with improved overall survival in cholangiocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25267294 2014 Polo-like kinase 3 regulates CtIP during DNA double-strand break repair in G1.
25202016 2014 Osmotic stress-induced phosphorylation of H2AX by polo-like kinase 3 affects cell cycle progression in human corneal epithelial cells.
22828320 2012 Investigation on PLK2 and PLK3 substrate recognition.
22549466 2012 Threonine-4 of mammalian RNA polymerase II CTD is targeted by Polo-like kinase 3 and required for transcriptional elongation.
21840391 2011 Bcl-xL phosphorylation at Ser49 by polo kinase 3 during cell cycle progression and checkpoints.
More...