Property Summary

Ligand Count 28
NCBI Gene PubMed Count 60
PubMed Score 93.97
PubTator Score 115.11

Knowledge Summary

Patent (21,767)

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.4e-30
non-small cell lung cancer 2890 3.8e-14
lung carcinoma 2843 1.3e-09
psoriasis 6694 8.3e-04
Disease Target Count Z-score Confidence
Cancer 2499 3.064 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.700 1.4e-30
lung carcinoma -1.600 1.3e-09
non-small cell lung cancer -1.331 3.8e-14
psoriasis 1.500 8.3e-04

Gene RIF (35)

AA Sequence

MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGRTYLKGRLLGK      1 - 70
GGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLE     71 - 140
LCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARL    141 - 210
EPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLP    211 - 280
ASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKS    281 - 350
LFGRKKKSKNHAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG    351 - 420
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFN    421 - 490
DGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAP    491 - 560
PLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLR    561 - 630
QRLRYALRLLRDRSPA                                                          631 - 646
//

Text Mined References (64)

PMID Year Title