Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.17
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.003
gastric cancer 1.100 0.002
oligodendroglioma 1.100 0.000
osteosarcoma 1.133 0.011
group 3 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.200 0.001
intraductal papillary-mucinous adenoma (... 1.100 0.043
lung cancer 1.100 0.005
pituitary cancer 1.100 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of O-sialoglycoprotein endopeptidase-like 1 (OSGEPL1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTE      1 - 70
VHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKK     71 - 140
PFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSL    141 - 210
IKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILS    211 - 280
SAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLC    281 - 350
PPPRLCTDNGIMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI          351 - 414
//

Text Mined References (8)

PMID Year Title
25162662 2014 Genome-wide association study identifies variants in PMS1 associated with serum ferritin in a Chinese population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19694617 2009 Eukaryotic GCP1 is a conserved mitochondrial protein required for progression of embryo development beyond the globular stage in Arabidopsis thaliana.
19578062 2009 Qri7/OSGEPL, the mitochondrial version of the universal Kae1/YgjD protein, is essential for mitochondrial genome maintenance.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.