Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.17
PubTator Score 0.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 3.77331804873242E-15
pituitary cancer 1972 2.66011006620965E-5
group 3 medulloblastoma 2254 7.08867494514874E-5
medulloblastoma, large-cell 6234 9.86701675461821E-5
primitive neuroectodermal tumor 3031 7.20046369320249E-4
gastric cancer 436 0.00159155005163598
Rheumatoid Arthritis 1171 0.0030072498519273
lung cancer 4473 0.00531838184839952
osteosarcoma 7933 0.010663940778545
intraductal papillary-mucinous adenoma (IPMA) 2956 0.043200336376864
Disease Target Count Z-score Confidence
Loeys-Dietz syndrome 23 4.536 2.3
Ehlers-Danlos syndrome 42 3.946 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.003
gastric cancer 1.100 0.002
oligodendroglioma 1.100 0.000
osteosarcoma 1.133 0.011
group 3 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.200 0.001
intraductal papillary-mucinous adenoma (... 1.100 0.043
lung cancer 1.100 0.005
pituitary cancer 1.100 0.000

Synonym

Accession Q9H4B0 Q96EV9 Q96NH5
Symbols Qri7
OSGEPL

Gene

PANTHER Protein Class (3)

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Pathway (1)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of O-sialoglycoprotein endopeptidase-like 1 (OSGEPL1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTE      1 - 70
VHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKK     71 - 140
PFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSL    141 - 210
IKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILS    211 - 280
SAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLC    281 - 350
PPPRLCTDNGIMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI          351 - 414
//

Text Mined References (8)

PMID Year Title
25162662 2014 Genome-wide association study identifies variants in PMS1 associated with serum ferritin in a Chinese population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19694617 2009 Eukaryotic GCP1 is a conserved mitochondrial protein required for progression of embryo development beyond the globular stage in Arabidopsis thaliana.
19578062 2009 Qri7/OSGEPL, the mitochondrial version of the universal Kae1/YgjD protein, is essential for mitochondrial genome maintenance.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.