Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.56
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 1.6e-03
group 3 medulloblastoma 1.400 7.1e-05
intraductal papillary-mucinous adenoma (... 1.100 4.3e-02
lung cancer 1.100 5.3e-03
medulloblastoma, large-cell 1.100 9.9e-05
oligodendroglioma 1.100 3.8e-15
osteosarcoma 1.133 1.1e-02
pituitary cancer 1.100 2.7e-05
primitive neuroectodermal tumor 1.200 7.2e-04
Rheumatoid arthritis -1.200 3.0e-03

Gene RIF (2)

AA Sequence

MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTE      1 - 70
VHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKK     71 - 140
PFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSL    141 - 210
IKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILS    211 - 280
SAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLC    281 - 350
PPPRLCTDNGIMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI          351 - 414
//

Text Mined References (8)

PMID Year Title