Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.83
PubTator Score 0.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.188 5.6e-03
Common variable immunodeficiency -1.024 2.5e-03
lung adenocarcinoma -1.781 6.9e-13
lung cancer -3.400 3.3e-06
lung carcinoma -1.400 2.2e-20
non-small cell lung cancer -2.610 4.1e-35
osteosarcoma -3.899 6.0e-07
psoriasis -1.500 6.3e-03
tuberculosis 1.600 1.3e-06

AA Sequence

MQPSGLEGPGTFGRWPLLSLLLLLLLLQPVTCAYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQ      1 - 70
GLQEQARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQT     71 - 140
QDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILPTFYMLGVRY    141 - 210
LTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIF    211 - 280
SHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGG    281 - 350
DYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDE    351 - 420
QLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVSESSPHMAPVLAVVATFPVLILWL        421 - 486
//

Text Mined References (11)

PMID Year Title