Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.28
PubTator Score 0.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.188 0.006
psoriasis -1.500 0.006
osteosarcoma -3.899 0.000
tuberculosis and treatment for 3 months 1.800 0.000
non-small cell lung cancer -2.610 0.000
Common variable immunodeficiency -1.024 0.002
lung cancer -3.400 0.000
lung adenocarcinoma -1.781 0.000
lung carcinoma -1.400 0.000

AA Sequence

MQPSGLEGPGTFGRWPLLSLLLLLLLLQPVTCAYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQ      1 - 70
GLQEQARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQT     71 - 140
QDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILPTFYMLGVRY    141 - 210
LTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIF    211 - 280
SHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGG    281 - 350
DYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDE    351 - 420
QLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVSESSPHMAPVLAVVATFPVLILWL        421 - 486
//

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12738806 2003 Identification of two additional members of the membrane-bound dipeptidase family.
More...