Property Summary

NCBI Gene PubMed Count 55
Grant Count 650
R01 Count 331
Funding $161,299,525.03
PubMed Score 4018.69
PubTator Score 631.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.623 0.001
psoriasis 1.500 0.000
osteosarcoma 2.010 0.000
ovarian cancer 1.500 0.006

Synonym

Accession Q9H4A6 Q9UIW5
Symbols GOPP1
GPP34
MIDAS
Vps74

Gene

PDB

3KN1  

Gene RIF (50)

PMID Text
26617771 Review/Meta-analysis: overexpression of GOLPH3 predicts poor prognosis in solid tumors.
26375441 GOLPH3 is likely to play important roles in bladder cancer progression via modulating AKT/mTOR signaling, and it is a novel prognostic biomarker and promising therapeutic target for bladder cancer.
26097550 GOLPH3 was expressed in prostate cancer cell lines. Our findings suggest GOLPH3 regulate MMP9 expression which impact cell migration and invasion.
25760033 GOLPH3 expression predicts poor prognosis in patients with prostate cancer undergoing radical prostatectomy.
25659977 The expression level of GOLPH3 is correlated with metastasis and prognosis in NSCLC, and GOLPH3 mediates metastasis by regulating the protein levels of MMP-2 and MMP-9 in vitro.
25634514 High GOLPH3 expression is associated with poor prognosis and invasion of hepatocellular carcinoma
25634214 Our recent investigation of the regulation of GOLPH3 revealed a surprising response by the Golgi upon DNA damage that is mediated by DNA-PK and GOLPH3.
25385148 Golgi phosphoprotein 3 (GOLPH3) promotes hepatocellular carcinoma cell aggressiveness by activating the NF-kappaB pathway.
25286393 The GOPLH3 expression level is highly correlated with Akt/mTOR signaling in human gastric cancer samples.
25246532 GOLPH3 has a role in triggering signal-mediated incorporation of glycosyltransferases into coatomer-coated vesicles
More...

AA Sequence

MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG      1 - 70
LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV     71 - 140
KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK    141 - 210
QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC    211 - 280
LKANTNEVLWAVVAAFTK                                                        281 - 298
//

Text Mined References (62)

PMID Year Title
26617771 2015 Golgi phosphoprotein3 overexpression is associated with poor survival in patients with solid tumors: a meta-analysis.
26375441 2015 GOLPH3 is a potential therapeutic target and a prognostic indicator of poor survival in bladder cancer treated by cystectomy.
26097550 2015 Golgi phosphoprotein 3 regulates metastasis of prostate cancer via matrix metalloproteinase 9.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25760033 2015 Golgi phosphoprotein 3 expression predicts poor prognosis in patients with prostate cancer undergoing radical prostatectomy.
25659977 2015 GOLPH3 overexpression is closely correlated with poor prognosis in human non-small cell lung cancer and mediates its metastasis through upregulating MMP-2 and MMP-9.
25634514 2015 High GOLPH3 expression is associated with poor prognosis and invasion of hepatocellular carcinoma.
25634214 2015 GOLPH3 links the Golgi, DNA damage, and cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25385148 2015 Golgi phosphoprotein 3 (GOLPH3) promotes hepatocellular carcinoma cell aggressiveness by activating the NF-?B pathway.
More...