Property Summary

NCBI Gene PubMed Count 63
PubMed Score 4208.31
PubTator Score 631.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.623 5.5e-04
osteosarcoma 2.010 4.3e-07
ovarian cancer 1.500 5.7e-03
psoriasis 1.500 1.2e-04

Gene RIF (58)

AA Sequence

MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG      1 - 70
LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV     71 - 140
KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK    141 - 210
QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC    211 - 280
LKANTNEVLWAVVAAFTK                                                        281 - 298
//

Text Mined References (70)

PMID Year Title