Tbio | Golgi phosphoprotein 3-like |
Phosphatidylinositol-4-phosphate-binding protein that may antagonize the action of GOLPH3 which is required for the process of vesicle budding at the Golgi and anterograde transport to the plasma membrane.
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008]
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Malignant neoplasm of prostate | 67 |
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 4.20300670065738E-7 |
hepatocellular carcinoma | 550 | 6.17785391849169E-6 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 2.72822463110118E-4 |
tuberculosis and treatment for 6 months | 686 | 2.76867088257212E-4 |
psoriasis | 6685 | 7.97053568146881E-4 |
gastric cancer | 436 | 8.84812595840349E-4 |
pancreatic cancer | 2300 | 0.00440969336484594 |
pancreatic carcinoma | 567 | 0.00440969336484596 |
Waldenstrons macroglobulinemia | 765 | 0.00445565094958319 |
astrocytoma | 1493 | 0.0186877169195385 |
spina bifida | 1064 | 0.0361464357493143 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0373633771541318 |
acute myeloid leukemia | 785 | 0.0385959172925509 |
Disease | log2 FC | p |
---|---|---|
gastric cancer | 1.100 | 0.001 |
hepatocellular carcinoma | 1.100 | 0.000 |
pancreatic cancer | 1.200 | 0.004 |
Waldenstrons macroglobulinemia | 1.071 | 0.004 |
psoriasis | -1.200 | 0.001 |
astrocytoma | 1.100 | 0.019 |
tuberculosis and treatment for 6 months | -1.700 | 0.000 |
intraductal papillary-mucinous adenoma (... | 1.600 | 0.000 |
intraductal papillary-mucinous neoplasm ... | 1.200 | 0.037 |
pancreatic carcinoma | 1.200 | 0.004 |
spina bifida | -1.088 | 0.036 |
acute myeloid leukemia | -1.300 | 0.039 |
ovarian cancer | -1.200 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
S.cerevisiae | OMA EggNOG |
PMID | Text |
---|---|
23345592 | GOLPH3L differs critically from GOLPH3 in that it is largely unable to bind to MYO18A; data demonstrate that despite their similarities, unexpectedly, GOLPH3L antagonizes GOLPH3/MYO18A at the Golgi |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDC 1 - 70 ISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIE 71 - 140 LLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLER 141 - 210 WVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLA 211 - 280 AFNKS 281 - 285 //
PMID | Year | Title |
---|---|---|
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25217961 | 2014 | A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer. |
24705354 | 2014 | The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease. |
23585552 | 2013 | Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment. |
23345592 | 2013 | GOLPH3L antagonizes GOLPH3 to determine Golgi morphology. |
23275563 | 2013 | Development and application of a DNA microarray-based yeast two-hybrid system. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22889169 | 2012 | A conserved N-terminal arginine-motif in GOLPH3-family proteins mediates binding to coatomer. |
21269460 | 2011 | Initial characterization of the human central proteome. |
More... |