Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.50
PubTator Score 1.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Malignant neoplasm of prostate 67
Disease Target Count P-value
ovarian cancer 8492 4.20300670065738E-7
hepatocellular carcinoma 550 6.17785391849169E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.72822463110118E-4
tuberculosis and treatment for 6 months 686 2.76867088257212E-4
psoriasis 6685 7.97053568146881E-4
gastric cancer 436 8.84812595840349E-4
pancreatic cancer 2300 0.00440969336484594
pancreatic carcinoma 567 0.00440969336484596
Waldenstrons macroglobulinemia 765 0.00445565094958319
astrocytoma 1493 0.0186877169195385
spina bifida 1064 0.0361464357493143
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0373633771541318
acute myeloid leukemia 785 0.0385959172925509

Expression

  Differential Expression (13)

Synonym

Accession Q9H4A5 B1AN09 B7Z6N3 Q9NVK0
Symbols GPP34R

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (2)

PMID Text
23345592 GOLPH3L differs critically from GOLPH3 in that it is largely unable to bind to MYO18A; data demonstrate that despite their similarities, unexpectedly, GOLPH3L antagonizes GOLPH3/MYO18A at the Golgi
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDC      1 - 70
ISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIE     71 - 140
LLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLER    141 - 210
WVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLA    211 - 280
AFNKS                                                                     281 - 285
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23345592 2013 GOLPH3L antagonizes GOLPH3 to determine Golgi morphology.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22889169 2012 A conserved N-terminal arginine-motif in GOLPH3-family proteins mediates binding to coatomer.
21269460 2011 Initial characterization of the human central proteome.
More...