Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.50
PubTator Score 1.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.300 3.9e-02
astrocytoma 1.100 1.9e-02
gastric cancer 1.100 8.8e-04
hepatocellular carcinoma 1.100 6.2e-06
intraductal papillary-mucinous adenoma (... 1.600 2.7e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.7e-02
ovarian cancer -1.200 4.2e-07
pancreatic cancer 1.200 4.4e-03
pancreatic carcinoma 1.200 4.4e-03
psoriasis -1.200 8.0e-04
spina bifida -1.088 3.6e-02
tuberculosis and treatment for 3 months -1.100 6.4e-03
Waldenstrons macroglobulinemia 1.071 4.5e-03

Gene RIF (2)

AA Sequence

MTTLTHRARRTEISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKEGYTSFWNDC      1 - 70
ISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKHIKATEPTETVQTWIE     71 - 140
LLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDMTTHPVTNTTEKQRLVKKLQDSVLER    141 - 210
WVNDPQRMDKRTLALLVLAHSSDVLENVFSSLTDDKYDVAMNRAKDLVELDPEVEGTKPSATEMIWAVLA    211 - 280
AFNKS                                                                     281 - 285
//

Text Mined References (18)

PMID Year Title