Property Summary

NCBI Gene PubMed Count 102
PubMed Score 617.62
PubTator Score 333.32

Knowledge Summary

Patent (82,433)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Neuropathy 261 3.079 1.5
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Kidney disease 430 4.345 2.2
Metabolic acidosis 90 4.222 2.1

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.400 3.0e-02
Alzheimer's disease 1.500 1.9e-02
astrocytoma 1.400 2.1e-02
Astrocytoma, Pilocytic -1.100 3.0e-02
atypical teratoid / rhabdoid tumor 1.600 1.2e-05
Breast cancer 1.100 7.9e-08
ependymoma -1.600 3.0e-06
esophageal adenocarcinoma -1.200 2.6e-02
gastric carcinoma 1.400 6.2e-03
glioblastoma -1.100 5.3e-03
group 3 medulloblastoma -1.100 4.5e-02
interstitial lung disease 1.100 2.5e-02
lung adenocarcinoma 1.253 1.9e-03
medulloblastoma, large-cell -2.200 1.9e-03
non primary Sjogren syndrome sicca -1.100 1.9e-02
osteosarcoma 1.309 1.4e-02
ovarian cancer 2.400 3.0e-06
Pick disease 1.200 1.5e-03
progressive supranuclear palsy 1.600 4.0e-02
psoriasis 1.400 3.8e-04
sarcoidosis 1.300 4.4e-02

Gene RIF (80)

AA Sequence

MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAA      1 - 70
TTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAA     71 - 140
AAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETK    141 - 210
AVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNI    211 - 280
VRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDL    281 - 350
KCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY    351 - 420
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELA    421 - 490
EEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKD    491 - 560
RVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE    561 - 630
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQA    631 - 700
QSQPHGVYPPSSVAQGQSQGQPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATT    701 - 770
AQPVSQPQAPQVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYP    771 - 840
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLLQPVTQLPSQV    841 - 910
HPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPM    911 - 980
PTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPGGSLAQAPTTSSQQAVLESTQGVSQVAPAEP    981 - 1050
VAVAQTQATQPTTLASSVDSAHSDVASGMSDGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKL   1051 - 1120
RILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADE   1121 - 1190
MLSEDVSVEPEGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIV   1191 - 1260
SPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPNTAPPNFSHTG   1261 - 1330
PTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTEEGIAGVATSTGVVTSGGLPI   1331 - 1400
PPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEIVVSSTALYPSVTVSATSASAGGSTATPGPK   1401 - 1470
PPAVVSQQAAGSTTVGATLTSVSTTTSFPSTASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGL   1471 - 1540
AFSLSAPSSSSSPGAGVSSYISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANV   1541 - 1610
PAVQQTLIHSQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET   1611 - 1680
SLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVSTTTSGVKPGTA   1681 - 1750
PSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSM   1751 - 1820
AAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGAQKEGKNKSEDAKSVHFESSTS   1821 - 1890
ESSVLSSSSPESTLVKPEPNGITIPGISSDVPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSV   1891 - 1960
SKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSP   1961 - 2030
HSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES   2031 - 2100
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASVLHPQQTLHPP   2101 - 2170
GNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTS   2171 - 2240
SRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNLGGSAPISAASA   2241 - 2310
TSLGHFTKSMCPPQQYGFPATPFGAQWSGTGGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLR   2311 - 2380
TT                                                                       2381 - 2382
//

Text Mined References (115)

PMID Year Title