Property Summary

NCBI Gene PubMed Count 99
Grant Count 89
R01 Count 63
Funding $9,861,744.29
PubMed Score 553.01
PubTator Score 333.32

Knowledge Summary

Patent (82,433)

Expression

  Differential Expression (21)

Disease log2 FC p
interstitial lung disease 1.100 0.025
esophageal adenocarcinoma -1.200 0.026
psoriasis 1.400 0.000
osteosarcoma 1.480 0.020
posterior fossa group B ependymoma -1.800 0.000
glioblastoma -2.000 0.000
astrocytoma 1.400 0.021
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma -1.200 0.024
medulloblastoma, large-cell -2.200 0.002
adult high grade glioma -1.400 0.030
pilocytic astrocytoma -1.100 0.026
non primary Sjogren syndrome sicca -1.100 0.019
lung adenocarcinoma 1.253 0.002
non-inflammatory breast cancer 1.100 0.001
Alzheimer's disease 1.500 0.019
Pick disease 2.000 0.000
progressive supranuclear palsy 1.600 0.040
gastric carcinoma 1.400 0.006
ovarian cancer 2.400 0.000
sarcoidosis 1.300 0.044

Synonym

Accession Q9H4A3 A1L4B0 C5HTZ5 C5HTZ6 C5HTZ7 H6WZW3 O15052 P54963 Q4VBX9 Q6IFS5 Q86WL5 Q8N673 Q96CZ6 Q9P1S9
Symbols KDP
PSK
p65
HSN2
HSAN2
PRKWNK1
PPP1R167

Gene

PDB

4PWN  

Gene RIF (77)

PMID Text
27082544 Single nucleotide polymorphisms STK39 and WNK were associated with hypertension and BP in our multicenter Belgian case-control study
26241057 findings indicate that the proline-rich exons are modular cassettes that convert WNK1 into a NEDD4-2 substrate, thereby linking aldosterone and other NEDD4-2-suppressing antinatriuretic hormones to NCC phosphorylation status.
26126716 these data provide insight into the mechanism regulating Cl(-) homeostasis in immature neurons, and suggest that WNK1-regulated changes in KCC2 phosphorylation contribute to the developmental excitatory-to-inhibitory GABA sequence.
25803323 Identify a new chimeric transcript generated by the fusion of WNK1 and B4GALNT3 genes, correlated with B4GALNT3 overexpression in papillary thyroid carcinoma.
25739019 a novel gene, WNK1, for susceptibility to pelvic organ prolapse
25477473 Report generation of WNK1 knockout cell lines and effects on WNK signaling.
25362046 study identifies a separation of functions for the WNK1-activated protein kinases OSR1 and SPAK in mediating proliferation, invasion, and gene expression in endothelial cells
25321950 conclude that although multiple candidate genes are involved in development of hypertension, the genetic polymorphism in WNK1 is not a major contributor to the observed variability in blood pressure and familial clustering risk of hypertension
25145935 enhances BK channel function by reducing ERK1/2 signaling-mediated lysosomal degradation of the channel
24803536 data suggest that WNK1 functions as a chloride sensor through direct binding of a regulatory chloride ion to the active site, which inhibits autophosphorylation
More...

AA Sequence

MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAA      1 - 70
TTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAA     71 - 140
AAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETK    141 - 210
AVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNI    211 - 280
VRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDL    281 - 350
KCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY    351 - 420
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELA    421 - 490
EEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKD    491 - 560
RVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE    561 - 630
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQA    631 - 700
QSQPHGVYPPSSVAQGQSQGQPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATT    701 - 770
AQPVSQPQAPQVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYP    771 - 840
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLLQPVTQLPSQV    841 - 910
HPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPM    911 - 980
PTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPGGSLAQAPTTSSQQAVLESTQGVSQVAPAEP    981 - 1050
VAVAQTQATQPTTLASSVDSAHSDVASGMSDGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKL   1051 - 1120
RILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADE   1121 - 1190
MLSEDVSVEPEGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIV   1191 - 1260
SPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPNTAPPNFSHTG   1261 - 1330
PTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTEEGIAGVATSTGVVTSGGLPI   1331 - 1400
PPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEIVVSSTALYPSVTVSATSASAGGSTATPGPK   1401 - 1470
PPAVVSQQAAGSTTVGATLTSVSTTTSFPSTASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGL   1471 - 1540
AFSLSAPSSSSSPGAGVSSYISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANV   1541 - 1610
PAVQQTLIHSQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET   1611 - 1680
SLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVSTTTSGVKPGTA   1681 - 1750
PSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSM   1751 - 1820
AAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGAQKEGKNKSEDAKSVHFESSTS   1821 - 1890
ESSVLSSSSPESTLVKPEPNGITIPGISSDVPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSV   1891 - 1960
SKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSP   1961 - 2030
HSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES   2031 - 2100
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASVLHPQQTLHPP   2101 - 2170
GNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTS   2171 - 2240
SRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNLGGSAPISAASA   2241 - 2310
TSLGHFTKSMCPPQQYGFPATPFGAQWSGTGGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLR   2311 - 2380
TT                                                                       2381 - 2382
//

Text Mined References (111)

PMID Year Title
27082544 2016 STK39 and WNK1 Are Potential Hypertension Susceptibility Genes in the BELHYPGEN Cohort.
26241057 2015 Alternatively spliced proline-rich cassettes link WNK1 to aldosterone action.
26126716 2015 WNK1-regulated inhibitory phosphorylation of the KCC2 cotransporter maintains the depolarizing action of GABA in immature neurons.
25803323 2015 New somatic mutations and WNK1-B4GALNT3 gene fusion in papillary thyroid carcinoma.
25739019 2015 Exome sequencing identifies a novel gene, WNK1, for susceptibility to pelvic organ prolapse (POP).
25477473 2015 Generation of WNK1 knockout cell lines by CRISPR/Cas-mediated genome editing.
25362046 2014 Actions of the protein kinase WNK1 on endothelial cells are differentially mediated by its substrate kinases OSR1 and SPAK.
25321950 2014 Lack of family-based association between common variations in WNK1 and blood pressure level.
25145935 2015 WNK1 activates large-conductance Ca2+-activated K+ channels through modulation of ERK1/2 signaling.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
More...