Property Summary

NCBI Gene PubMed Count 13
Grant Count 63
R01 Count 27
Funding $30,572,831.8
PubMed Score 112.45
PubTator Score 38.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.800 0.000
osteosarcoma -2.999 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.001
group 3 medulloblastoma 1.700 0.000
ovarian cancer 1.600 0.000
Breast cancer 1.200 0.000

Synonym

Accession Q9H497 B4DSY0 B7ZB65 Q5M7Y7 Q8WVA7 Q8WWM2 Q9H495 Q9H6E7
Symbols ADIR
ADIR2

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRGPWRQLWLFFLLLLPGAPEPRGASRPWEGTDEPGSAWAWPGFQRLQEQLRAAGALSKRYWTLFSCQV      1 - 70
WPDDCDEDEEAATGPLGWRLPLLGQRYLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLV     71 - 140
QQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVD    141 - 210
LYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPEGHRAESPWTIFLFLSNLRGDII    211 - 280
NEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDA    281 - 350
FLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS                           351 - 397
//

Text Mined References (14)

PMID Year Title
23569223 2013 Regulation of Torsin ATPases by LAP1 and LULL1.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20015956 2010 Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...