Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 8.03

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H496 Q05BU2
Symbols NET9
LULL1
IFRG15

Gene

 Compartment GO Term (0)

Gene RIF (5)

PMID Text
26041288 The Torsin Activator LULL1 Is Required for Efficient Growth of Herpes Simplex Virus 1.
25352667 LAP1 and LULL1 regulate Torsin ATPase activity through an active site complementation mechanism.
23569223 LAP1 and LULL1 as regulatory cofactors that are responsible for the activation of TorA's ATPase activity.
19339278 Data suggest that LULL1 regulates the distribution and activity of TorA within the ER and NE lumen and reveal functional defects in the mutant protein responsible for DYT1 dystonia.
15767459 identifed a novel transmembrane protein, lumenal domain like LAP1 (LULL1), which appears to interact with torsinA; it resides in the main endoplasmic reticulum.

AA Sequence

MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPL      1 - 70
EWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK              71 - 131
//

Text Mined References (13)

PMID Year Title
26041288 2015 The Torsin Activator LULL1 Is Required for Efficient Growth of Herpes Simplex Virus 1.
25416956 2014 A proteome-scale map of the human interactome network.
25352667 2014 The mechanism of Torsin ATPase activation.
24275647 2014 Arresting a Torsin ATPase reshapes the endoplasmic reticulum.
23569223 2013 Regulation of Torsin ATPases by LAP1 and LULL1.
19339278 2009 LULL1 retargets TorsinA to the nuclear envelope revealing an activity that is impaired by the DYT1 dystonia mutation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15767459 2005 The AAA+ protein torsinA interacts with a conserved domain present in LAP1 and a novel ER protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...