Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 8.03

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPL      1 - 70
EWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK              71 - 131
//

Text Mined References (16)

PMID Year Title