Property Summary

NCBI Gene PubMed Count 163
PubMed Score 134.07
PubTator Score 575.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 3.5e-04
astrocytic glioma -1.900 1.2e-03
Astrocytoma, Pilocytic -1.100 1.1e-06
ependymoma -1.500 1.6e-02
glioblastoma -1.200 4.2e-09
lung carcinoma 1.100 2.0e-22
medulloblastoma, large-cell -1.400 2.0e-03
oligodendroglioma -1.500 3.3e-03
Pick disease -1.300 5.0e-07
primitive neuroectodermal tumor -1.300 6.1e-03
subependymal giant cell astrocytoma -1.389 3.5e-02

Gene RIF (135)

AA Sequence

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRR      1 - 70
LQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF                        71 - 121
//

Text Mined References (168)

PMID Year Title