Property Summary

NCBI Gene PubMed Count 142
Grant Count 5
R01 Count 3
Funding $451,268.1
PubMed Score 119.77
PubTator Score 575.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.000 0.004
ependymoma -1.500 0.016
oligodendroglioma -1.500 0.003
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.002
primitive neuroectodermal tumor -1.300 0.006
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -1.389 0.035
lung carcinoma 1.100 0.000
Pick disease -1.500 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463193 screening 1904 / 52 / 192541 High-content cell-based screening for modulators of autophagy

Gene RIF (118)

PMID Text
26722036 Autophagy status, as determined by combined LC3, Beclin 1 and p62 expression, might be independently associated with poor survival in patients with gastric cancer.
26676801 Consistent with the in vitro results, we observed that the expression of autophagy marker LC3 was increased.
26468287 FYCO1 requires a functional LC3A/B-preferring LC3-interacting Region (LIR) motif to facilitate efficient maturation of autophagosomes under basal conditions, whereas starvation-induced autophagy was unaffected
26395023 up-regulated expression during the monocyte-to-dendritic cell transition
26350055 Up-regulation of LC3 is associated with carcinogenesis and progression of Salivary Adenoid Cystic Carcinoma.
26330555 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
26150155 Western blot and immunofluorescence validated antibody specificity, knockdown efficiency and autophagy induction prior to fixation in formalin and embedding in paraffin. LC3B and p62 antibodies were validated on cell pellets
26097572 In colorectal cancer, differentiation degree and lymph node metastasis were associated with LC3 overexpression. LC3 expression was significantly higher in cancerous tissue than in adjacent tissue.
26090585 LC3 is exploited by coxsackievirus in both autophagy-dependent and -independent manners in vivo
26084608 high nuclear HMGB1 levels and cytoplasmic HMGB1 expression predicted poor overall survival (OS) and disease-free survival (DFS). Meanwhile, high LC3 expression was associated with favorable prognosis.
More...

AA Sequence

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRR      1 - 70
LQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF                        71 - 121
//

Text Mined References (147)

PMID Year Title
26722036 2016 Clinicopathological Correlations of Autophagy-related Proteins LC3, Beclin 1 and p62 in Gastric Cancer.
26676801 2016 Selenite-induced autophagy antagonizes apoptosis in colorectal cancer cells in vitro and in vivo.
26468287 2015 FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy.
26395023 2015 IL-10 restricts dendritic cell (DC) growth at the monocyte-to-monocyte-derived DC interface by disrupting anti-apoptotic and cytoprotective autophagic molecular machinery.
26350055 2016 Expression of LC3, LAMP2, KEAP1 and NRF2 in Salivary Adenoid Cystic Carcinoma.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26150155 2015 Reliable LC3 and p62 autophagy marker detection in formalin fixed paraffin embedded human tissue by immunohistochemistry.
26097572 2015 Expression and clinical significances of Beclin1, LC3 and mTOR in colorectal cancer.
26090585 2015 Coxsackievirus can exploit LC3 in both autophagy-dependent and -independent manners in vivo.
26084608 2015 HMGB1 overexpression correlates with poor prognosis in early-stage squamous cervical cancer.
More...