Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $404,969.5
PubMed Score 9.25
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 0.000

Synonym

Accession Q9H490 Q7Z489 Q8N2F2
Symbols GAB1
CDC91L1

Gene

Gene RIF (3)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20224305 Observational study of gene-disease association. (HuGE Navigator)
15034568 CDC91L1 is an oncogene in bladder cancer, and implicate the GPI anchoring system as a potential oncogenic pathway and therapeutic target in human cancers

AA Sequence

MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLII      1 - 70
YLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKV     71 - 140
ALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQR    141 - 210
QYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAE    211 - 280
MFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYR    281 - 350
FLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGL    351 - 420
YLTAKDGTEAMLVLK                                                           421 - 435
//

Text Mined References (15)

PMID Year Title
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20224305 2010 Modest association of malignant melanoma with the rs910873 and rs1885120 markers on chromosome 20: a population-based study.
19946888 2010 Defining the membrane proteome of NK cells.
18488026 2008 Common sequence variants on 20q11.22 confer melanoma susceptibility.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15034568 2004 CDC91L1 (PIG-U) is a newly discovered oncogene in human bladder cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660601 2004 A conserved proline in the last transmembrane segment of Gaa1 is required for glycosylphosphatidylinositol (GPI) recognition by GPI transamidase.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...