Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.33
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.8e-06
Disease Target Count Z-score Confidence
Melanoma 711 0.0 3.0
Disease Target Count Z-score Confidence
Urinary bladder cancer 36 3.539 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 1.8e-06

Gene RIF (3)

AA Sequence

MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLII      1 - 70
YLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKV     71 - 140
ALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQR    141 - 210
QYIPVKMKSKAFWIFSWEYAMMYVGSLVVIICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAE    211 - 280
MFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYR    281 - 350
FLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGL    351 - 420
YLTAKDGTEAMLVLK                                                           421 - 435
//

Text Mined References (15)

PMID Year Title