Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H489 Q3MJ63 Q3MJ65 TSPY-like protein 3
Symbols TSPYL3
bA392M18.1

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MADKRAGTPEAAARPPPGLAREGDARTVPAARAREAGGRGSLHPAAGPGTAFPSPGRGEAASTATTPSLE      1 - 70
NGRVRDEAPETCGAEGLGTRAGASEKAEDANKEEGAIFKKEPAEEVEKQQEGEEKQEVAAEAQEGPRLLN     71 - 140
LGALIVDPLEAIQWEAEAVSAQADRAYLPLERRFGRMHRLYLARRSFIIQNIPGFWVTAFLNHPQLSAMI    141 - 210
SPRDEDMLCYLMNLEVRELRHSRTGCKFKFRFWSNPYFQNKVIVKEYECRASGRVVSIATRIRWHWGQEP    211 - 280
PALVHRNRDTVRSFFSWFSQHSLPEADRVAQIIKDDLWPNPLQYYLLGDRPCRARGGLARWPTETPSRPY    281 - 350
GFQSG                                                                     351 - 355
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.