Property Summary

NCBI Gene PubMed Count 22
Grant Count 30
R01 Count 24
Funding $2,689,810.6
PubMed Score 32.67
PubTator Score 18.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
27003260 High expression of POFUT1 correlates with aggressive clinicopathological characteristics and poor prognosis of hepatocellular carcinoma patients.
25229252 Identification of six pathogenic POFUT1 mutations in Dowling-Degos disease patients of different ethnic origin.
25165882 The upregulation of poFUT1 by LIF facilitated trophoblast cell migration and invasion through activating the PI3K/Akt signaling pathway.
25157627 Only a novel 1-bp deletion (c.246+5delG) in POFUT1 was found in a Chinese family with Dowling-Degos disease (DDD). No other novel mutation or this deletion was detected in POFUT1 in a second DDD family and a sporadic DDD case by Sanger Sequencing.
25107841 Silencing of Pofut1 expression exerted antiproliferative and antiadhesive effects on hepatocytes.
24064921 POFUT1 expression can contribute to cancer progression and that POFUT1 may serve as a diagnostic marker and a therapeutic target for OSCCs.
23684010 The protein product of POFUT1 plays a significant and conserved role in melanin synthesis and transport.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides upregulate gene expression of protein O-fucosyltransferase 1 (POFUT1) in U-937 macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18347015 Pofut1 and O-fucose have roles in mammalian Notch signaling
More...

AA Sequence

MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW      1 - 70
IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC     71 - 140
PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK    141 - 210
YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM    211 - 280
TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF    281 - 350
IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF                                    351 - 388
//

Text Mined References (27)

PMID Year Title
27003260 2016 Overexpression of protein O-fucosyltransferase 1 accelerates hepatocellular carcinoma progression via the Notch signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25229252 2015 Pathogenicity of POFUT1 in Dowling-Degos disease: additional mutations and clinical overlap with reticulate acropigmentation of kitamura.
25165882 2014 LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface.
25157627 2014 Analysis of POFUT1 gene mutation in a Chinese family with Dowling-Degos disease.
25107841 2014 Downregulated protein O-fucosyl transferase 1 (Pofut1) expression exerts antiproliferative and antiadhesive effects on hepatocytes by inhibiting Notch signalling.
24064921 2013 Protein O-fucosyltransferase 1: a potential diagnostic marker and therapeutic target for human oral cancer.
23684010 2013 Mutations in POFUT1, encoding protein O-fucosyltransferase 1, cause generalized Dowling-Degos disease.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...