Property Summary

NCBI Gene PubMed Count 26
PubMed Score 37.54
PubTator Score 18.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

AA Sequence

MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW      1 - 70
IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC     71 - 140
PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK    141 - 210
YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM    211 - 280
TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF    281 - 350
IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF                                    351 - 388
//

Text Mined References (31)

PMID Year Title