Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9H478
Symbols BWRT
HSA404617

Gene

 Compartment GO Term (1)

AA Sequence

MGRKWSGPTAEHQLPMPPPGVRLDSWKGVASGCSPSKASQEARGKEKCPTLNGQPQWSALFTLPPQRE        1 - 68
//

Text Mined References (6)

PMID Year Title
22067257 2011 Epigenetic-aging-signature to determine age in different tissues.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11063728 2000 Sequence and functional comparison in the Beckwith-Wiedemann region: implications for a novel imprinting centre and extended imprinting.
11056398 2000 A novel imprinted gene, KCNQ1DN, within the WT2 critical region of human chromosome 11p15.5 and its reduced expression in Wilms' tumors.