Property Summary

NCBI Gene PubMed Count 7
PubMed Score 269.23
PubTator Score 10.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.000 2.3e-06
astrocytic glioma -1.100 2.3e-02
Astrocytoma, Pilocytic -1.200 6.1e-06
atypical teratoid / rhabdoid tumor -2.100 3.3e-09
ependymoma -1.400 2.6e-08
glioblastoma -1.600 1.3e-07
group 4 medulloblastoma -1.500 1.8e-05
medulloblastoma, large-cell -1.600 6.7e-06
ovarian cancer -1.100 1.5e-04
primitive neuroectodermal tumor -1.400 4.3e-05
psoriasis 2.200 2.7e-05

AA Sequence

MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQV      1 - 70
GPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCP     71 - 140
RLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAA    141 - 210
VQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLH    211 - 280
QALVLLQDMAGFAPFVNLQV                                                      281 - 300
//

Text Mined References (8)

PMID Year Title