Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.86
PubTator Score 9.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.132 0.001
lung cancer 1.300 0.016
ovarian cancer 2.000 0.000

Synonym

Accession Q9H467 D3DR88 Q9BWG8
Symbols C10orf66
bA18I14.5

Gene

Gene RIF (9)

PMID Text
26023733 Results suggest that decreased expression of CUEDC2 contributes to tumor growth in lung adenocarcinoma, leading to a poor clinical outcome.
24882011 CUEDC2 plays a crucial role in modulating macrophage function and is associated with both colitis and colon tumorigenesis.
24125838 High CUEDC2 sensitizes chronic myeloid leukemic cells to imatinib treatment.
23776205 In response to UV irradiation, CUEDC2 undergoes ERK1/2-dependent phosphorylation and ubiquitin-dependent degradation, leading to APC/C(Cdh1)-mediated cyclin A destruction, cyclin-dependent kinase 2 inactivation, and G1 arrest.
22084247 a new biological activity for CUEDC2 as the regulator of JAK1/STAT3 signaling and the mechanism by which SOCS3 has been linked to suppression of the JAK/STAT pathway
21743465 CUEDC2 is a cell-cycle regulator that promotes spindle checkpoint inactivation and releases APC/C from checkpoint inhibition. CUEDC2 is phosphorylated by Cdk1 during mitosis.
21572428 key factor in endocrine resistance in breast cancer
17347654 These results identify a key post-translational mechanism that controls progesterone receptor protein levels and for the first time provide an important insight into the function of CUEDC2 in breast cancer proliferation.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAH      1 - 70
IPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATG     71 - 140
AEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKD    141 - 210
ELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKP    211 - 280
ARKYRFH                                                                   281 - 287
//

Text Mined References (21)

PMID Year Title
26023733 2015 CUEDC2 down-regulation is associated with tumor growth and poor prognosis in lung adenocarcinoma.
25534755 2015 A genome-wide association study of autism using the Simons Simplex Collection: Does reducing phenotypic heterogeneity in autism increase genetic homogeneity?
24882011 2014 Dysregulation of the miR-324-5p-CUEDC2 axis leads to macrophage dysfunction and is associated with colon cancer.
24685480 2014 CUEDC2 interacts with heat shock protein 70 and negatively regulates its chaperone activity.
24125838 2013 CUEDC2 sensitizes chronic myeloid leukemic cells to imatinib treatment.
23776205 2013 Phosphorylation-triggered CUEDC2 degradation promotes UV-induced G1 arrest through APC/C(Cdh1) regulation.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22084247 2012 CUEDC2 (CUE domain-containing 2) and SOCS3 (suppressors of cytokine signaling 3) cooperate to negatively regulate Janus kinase 1/signal transducers and activators of transcription 3 signaling.
21743465 2011 Cdk1-phosphorylated CUEDC2 promotes spindle checkpoint inactivation and chromosomal instability.
More...