Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.04
PubTator Score 9.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8297 2.8e-06
Multiple myeloma 1296 1.1e-03
lung cancer 4607 1.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 1.6e-02
Multiple myeloma 1.132 1.1e-03
ovarian cancer 2.000 2.8e-06

Synonym

Accession Q9H467 D3DR88 Q9BWG8
Symbols C10orf66
bA18I14.5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAH      1 - 70
IPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATG     71 - 140
AEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKD    141 - 210
ELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKP    211 - 280
ARKYRFH                                                                   281 - 287
//

Text Mined References (22)

PMID Year Title