Property Summary

NCBI Gene PubMed Count 30
Grant Count 22
R01 Count 10
Funding $2,170,119.34
PubMed Score 36.29
PubTator Score 18.71

Knowledge Summary

Patent (16,171)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.700 0.014
ependymoma -1.800 0.023
oligodendroglioma -1.700 0.016
osteosarcoma -1.549 0.014
cystic fibrosis 2.794 0.000
atypical teratoid / rhabdoid tumor 2.100 0.001
glioblastoma -1.600 0.005
medulloblastoma, large-cell -1.500 0.031
pediatric high grade glioma -1.200 0.020
Breast cancer -1.700 0.000
ovarian cancer -1.100 0.003
psoriasis -1.200 0.000

Gene RIF (11)

PMID Text
26797711 Frizzled-8 has an important pro-inflammatory role and suggest that its expression is related to chronic bronchitis.
26590425 Study concludes that expression of Fzd8 is repressed in multiple cancers and suggest it may have a role as a tumor suppressor.
25702574 report the discovery of a human-accelerated regulatory enhancer (HARE5) of FZD8, a receptor of the Wnt pathway implicated in brain development and size
25320014 c-Met upregulated FZD8 through the ERK/c-Fos cascade in HN-CSC. Taken together, our results offer a preclinical proof-of-concept for targeting the c-Met/FZD8 signaling axis as a CSC-directed therapy to improve HNSCC treatment
23815780 We demonstrated an activation of Wnt-2 signaling via the Frizzled-8 receptor in non-small cell lung cancer cells
22738385 APF has been shown to be a nine-residue frizzled-8 protein-related sialoglycopeptide. Subsequent research has gradually clarified the molecular mechanisms underlying the profound antiproliferative effect of APF.
22303445 Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors.
21872498 These observations suggest that c-Jun is involved in APF-mediated inhibition for bladder tumor cell growth
20634891 Observational study of gene-disease association. (HuGE Navigator)
20093360 analysis of the frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6
More...

AA Sequence

MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVH      1 - 70
QFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPE     71 - 140
QGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGGRGGGGGDAAAPPAR    141 - 210
GGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFW    211 - 280
IGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGA    281 - 350
GGAGGAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT    351 - 420
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLV    421 - 490
IYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPR    491 - 560
WEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWASKGAAVG    561 - 630
GGAGATAAGGGGGPGGGGGGGPGGGGGPGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV          631 - 694
//

Text Mined References (31)

PMID Year Title
26797711 2016 A pro-inflammatory role for the Frizzled-8 receptor in chronic bronchitis.
26590425 2015 K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.
25702574 2015 Human-chimpanzee differences in a FZD8 enhancer alter cell-cycle dynamics in the developing neocortex.
25320014 2014 Targeting the c-Met/FZD8 signaling axis eliminates patient-derived cancer stem-like cells in head and neck squamous carcinomas.
23815780 2013 Frizzled-8 receptor is activated by the Wnt-2 ligand in non-small cell lung cancer.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22738385 2012 Integration analysis of quantitative proteomics and transcriptomics data identifies potential targets of frizzled-8 protein-related antiproliferative factor in vivo.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22682250 2012 Complement C1q activates canonical Wnt signaling and promotes aging-related phenotypes.
22575959 2012 ZNRF3 promotes Wnt receptor turnover in an R-spondin-sensitive manner.
More...