Property Summary

NCBI Gene PubMed Count 34
PubMed Score 42.53
PubTator Score 18.71

Knowledge Summary

Patent (16,171)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 0.7
Disease Target Count Z-score Confidence
interstitial cystitis 2312 4.492 2.2

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.700 1.4e-02
atypical teratoid / rhabdoid tumor 1.100 1.6e-02
Breast cancer -1.700 7.4e-05
cystic fibrosis 2.794 1.2e-06
ependymoma -1.800 2.3e-02
glioblastoma -1.600 5.1e-03
medulloblastoma, large-cell -1.500 3.1e-02
oligodendroglioma -1.700 1.6e-02
osteosarcoma 1.266 4.3e-04
ovarian cancer -1.100 3.2e-03
pediatric high grade glioma -1.200 2.0e-02
psoriasis -1.200 2.7e-43

Gene RIF (14)

AA Sequence

MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVH      1 - 70
QFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPE     71 - 140
QGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGGRGGGGGDAAAPPAR    141 - 210
GGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFW    211 - 280
IGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGA    281 - 350
GGAGGAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLT    351 - 420
WFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLV    421 - 490
IYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPR    491 - 560
WEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWASKGAAVG    561 - 630
GGAGATAAGGGGGPGGGGGGGPGGGGGPGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV          631 - 694
//

Text Mined References (35)

PMID Year Title