Property Summary

NCBI Gene PubMed Count 56
PubMed Score 4.55
PubTator Score 23.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.600 3.1e-03
atypical teratoid / rhabdoid tumor -1.400 3.3e-03
Breast cancer 2.400 2.5e-02
medulloblastoma -1.200 3.9e-03
medulloblastoma, large-cell -2.100 7.1e-05
ovarian cancer -1.300 7.0e-05
pancreatic cancer 1.100 1.5e-02
Pick disease -1.100 1.2e-05
primary pancreatic ductal adenocarcinoma 1.266 6.8e-03
ulcerative colitis -1.200 7.1e-09

 MGI Phenotype (1)

Gene RIF (27)

AA Sequence

MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALK      1 - 70
RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQE     71 - 140
LAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEE    141 - 210
DDDMKELENWAGSM                                                            211 - 224
//

Text Mined References (65)

PMID Year Title