Property Summary

NCBI Gene PubMed Count 50
Grant Count 4
R01 Count 1
Funding $1,287,505.5
PubMed Score 3.97
PubTator Score 23.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 0.003
medulloblastoma -1.200 0.004
medulloblastoma, large-cell -2.100 0.000
primary pancreatic ductal adenocarcinoma 1.266 0.007
Breast cancer 2.400 0.025
adult high grade glioma -1.600 0.003
Pick disease -1.100 0.000
ulcerative colitis -1.200 0.000
ovarian cancer -1.300 0.000
pancreatic cancer 1.100 0.015

Synonym

Accession Q9H444 E1P5N4 Q53ZD6
Symbols SNF7
CTPP3
Shax1
CHMP4A
SNF7-2
VPS32B
CTRCT31
Vps32-2
C20orf178
dJ553F4.4

Gene

PANTHER Protein Class (1)

PDB

3C3Q   3UM3   4ABM  

Gene RIF (32)

PMID Text
26929449 The ESCRT-III subunit CHMP4B is a key effector in abscission, whereas its paralogue, CHMP4C, is a component in the abscission checkpoint that delays abscission until chromatin is cleared from the intercellular bridge.
26866605 homologous domain of human Bro1 domain-containing proteins, Alix and Brox, binds CHMP4B but not STAM2, despite their high structural similarity
25874485 our results implied that CHMP4B could be a promising prognostic biomarker as well as a potential therapeutic target of HCC.
25710462 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25710462 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25010285 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
24741567 CHMP4B, through its association with chromatin, may participate in the autophagolysosomal degradation of micronuclei and other extranuclear chromatin.
More...

AA Sequence

MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALK      1 - 70
RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQE     71 - 140
LAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEE    141 - 210
DDDMKELENWAGSM                                                            211 - 224
//

Text Mined References (59)

PMID Year Title
26929449 2016 ALIX and ESCRT-I/II function as parallel ESCRT-III recruiters in cytokinetic abscission.
26866605 2016 Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26040712 2015 Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
25874485 2015 High CHMP4B expression is associated with accelerated cell proliferation and resistance to doxorubicin in hepatocellular carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24741567 2014 Association of CHMP4B and autophagy with micronuclei: implications for cataract formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107264 2013 ESCRT requirements for EIAV budding.
More...