Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.89
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.62648619843527E-26
posterior fossa group B ependymoma 1530 2.92545258579298E-14
atypical teratoid / rhabdoid tumor 4369 9.8921353742732E-9
pilocytic astrocytoma 3086 2.16914736284603E-8
medulloblastoma 1524 2.62452277038394E-6
pituitary cancer 1972 2.97647150351274E-5
medulloblastoma, large-cell 6234 6.34746556115444E-5
adult high grade glioma 2148 6.78218775347406E-5
glioblastoma 5572 7.5019197250772E-4
primitive neuroectodermal tumor 3031 0.00142279520426019
Disease Target Count Z-score Confidence
Polydactyly 93 3.208 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma -2.400 0.000
glioblastoma -1.900 0.001
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.500 0.001
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -2.000 0.000
pituitary cancer 1.300 0.000
psoriasis -1.900 0.000

Synonym

Accession Q9H426 A4FU94 E1P613 Q3MI44 Q5JWT7
Symbols RIM4
RIM 4
RIM-4
C20orf190
RIM4gamma
RIM4-gamma

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of regulating synaptic membrane exocytosis 4 (RIMS4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MERSQSRLSLSASFEALAIYFPCMNSFDDEDAGDSRRLKGAIQRSTETGLAVEMPSRTLRQASHESIEDS      1 - 70
MNSYGSEGNLNYGGVCLASDAQFSDFLGSMGPAQFVGRQTLATTPMGDVEIGLQERNGQLEVDIIQARGL     71 - 140
TAKPGSKTLPAAYIKAYLLENGICIAKKKTKVARKSLDPLYNQVLLFPESPQGKVLQVIVWGNYGRMERK    141 - 210
QFMGVARVLLEELDLTTLAVGWYKLFPTSSMVDPATGPLLRQASQLSLESTVGPCGERS               211 - 269
//

Text Mined References (9)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620390 2003 Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.